KEGG   Lysobacter enzymogenes M497-1: LEN_4604Help
Entry
LEN_4604          CDS       T04598                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lem  Lysobacter enzymogenes M497-1
Pathway
lem00620  Pyruvate metabolism
lem00680  Methane metabolism
lem01100  Metabolic pathways
lem01120  Microbial metabolism in diverse environments
lem01200  Carbon metabolism
Module
lem_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lem00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LEN_4604 (ppc)
  Energy metabolism
   00680 Methane metabolism
    LEN_4604 (ppc)
Enzymes [BR:lem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LEN_4604 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DinB_2
Motif
Other DBs
NCBI-ProteinID: BAW00092
UniProt: A0A1J1EPC6
LinkDB All DBs
Position
complement(5735154..5737925)
Genome map
AA seq 923 aa AA seqDB search
MTDSSDEPLRAAEWAEQAAERAADFAPTDALLREDVKTLGALVGEILAEQRGQGFLDGVE
RLRRAAIRRREAGEPIDALAAALVDIDLEQAADLVRAFATYFQAVNLAERVHRIRRRRDY
ERSGAGAQPGGLRDALATLARQGVSAEEVAALLPRLRIEPVFTAHPTEAVRRALLEKERT
IVECLVADIDRGRTPPERRADRERIRLALTASWQTAEAPAAKPSVADEFEHVGFYLSDVL
YRVLPVYYEVFEEALRETYGGAPALPDVLGFGTWVGGDMDGNPNVGADTIAATLAGQRAL
VLAAYRRDLASLEELLSQSVHRVRVDDAVLAKVEDYRYLLPKAAALLKPRHADMPYRNLL
GLMSARLQATLEESVHGYPDAAAFLADIDLIERSLAAHQGAHAGGFAVRRLRRRAECFGF
HLAGLDLRQDSATHDAALAALFEQPEWAALDVAARAARLHQLLDGEAPPARPAAAAAQPT
LDVFRAVARLRPRFGARAFGPYIVSMSRSAADALAVLALARTAGCADDKGRVPLDVAPLF
ETVDDLDAAADTLRALFSDPVYRDHLCSRGDRQVVMLGYSDSAKDGGMVASRWALQQTQI
ALTALAADSGVRIAFFHGRGGSISRGGGKTERAVIAAPRGSVDGYLRLTEQGEVIHRKYG
IRALALRNLEQTSGAVLRATLRPRAPEPREAGWRRIAGELAGEARAHYRALVHEDPQFPA
YFRAATPIDVIERLRIGSRPAKRAGSGDISSLRAIPWVFAWSQNRAGLTAWYGVGTGLAA
ALDRHGRDTLAEMARDWPFFGTLIDDLEMVLAKSDPAIFERYSQLASALPDGDLHARFHP
SIAAEFERTRDAVLAIKGSDELLRGDHRLRQSIRLRNPYVDPISLLQVDLLARWRAADRP
DDALLQALVATVNGIAAGVQNTG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagcagcgacgaacctttgcgtgccgcggaatgggccgagcaggcggccgaa
cgcgcggccgacttcgcccccaccgatgctttattgcgcgaggacgtgaaaaccctcggc
gcgctggtcggcgagatccttgccgaacagcgcgggcaaggcttcctcgacggcgtcgag
cgcttgcgccgcgccgcgatccgccggcgcgaagccggcgaacccatcgacgcgctggcc
gcggcgctggtcgacatcgatctcgaacaagccgccgatctggtccgcgcgttcgccacc
tacttccaggcggtcaacctggccgagcgcgtgcaccgcatccgccgccgccgcgactac
gagcgcagcggcgccggcgcccagcccggcggcctgcgtgacgcgctggcgaccctggcg
cggcaaggcgtcagcgccgaggaagtggccgcgctgttgccgcggctgcggatcgagccg
gtgttcaccgcccacccgaccgaagcggtgcggcgcgcgttgctggagaaggaacgcacc
atcgtcgaatgcctggtcgccgacatcgaccgcggccgcaccccgcccgagcgccgcgcc
gaccgcgagcgcatccgtctggcgctgaccgcgagctggcagaccgccgaagcgccggcg
gccaagcccagcgtcgccgacgaattcgagcacgtgggtttctatctgtccgacgtgctg
taccgggtgctgccggtctattacgaagtgttcgaagaagccttgcgcgaaacctacggc
ggcgcgccggcgctgcccgacgtgctcggcttcggcacctgggtcggcggcgacatggac
ggcaatccgaatgtcggcgccgacaccatcgccgccacgctcgccggccagcgcgcgctg
gtgctggcggcgtaccggcgcgatctggcctcgctggaagaattgctgagccagtcggtg
caccgcgtgcgcgtcgacgacgcggtgctggccaaggtcgaggattatcgctacctgctg
cccaaggccgccgcgctgctcaagccgcgccacgccgacatgccgtatcgcaacctgctc
gggctgatgtcggcgcgcttgcaggccacgctggaagagagcgtgcacggctatcccgac
gccgccgcgttcctggccgacatcgatttgatcgaacgcagtctggccgcgcaccagggc
gcgcacgccggcggcttcgcggtgcggcgcctgcgccggcgcgcggaatgcttcggcttc
catctggccgggctcgacctgcgccaggattcggccacccacgacgccgcgctggcggcg
ctgttcgagcagcccgaatgggccgcgctcgacgtcgctgcgcgcgccgcgcgtctgcac
cagttgctcgacggcgaagcgccgccggcgcgtccggccgcggccgcggcgcagccgacg
ctggacgtgttccgtgcggtcgcgcggctgcgcccgcgcttcggcgcgcgcgcattcggc
ccctacatcgtcagcatgagccgcagcgccgccgacgcgctggcggtgctggcgctggcg
cgcaccgccggttgcgccgacgacaaggggcgggtgccgctggacgtggcgccgctgttc
gaaaccgtcgacgacctcgacgccgccgccgacaccttgcgcgcgctgttctctgacccg
gtgtatcgcgatcacctgtgctcgcgcggcgaccgccaggtggtgatgctgggctattcc
gacagcgccaaggacggcggcatggtcgcttcgcgctgggcgctgcagcagacccagatc
gcgctgaccgcgctggccgccgacagcggcgtgcgcatcgcgttcttccacggccgcggc
ggctcgatcagccgcggcggcggcaagaccgagcgcgcggtgatcgccgcgccgcgcggt
tcggtcgacggctatctgcgtttgaccgagcagggcgaggtgatccatcgcaagtacggc
atccgcgcgctggcgctgcgcaatctggagcagaccagcggcgcggtgctgcgcgcgacc
ctgcgcccgcgcgcgccggagccgcgcgaggccgggtggcgccggatcgccggcgaactc
gccggcgaggcgcgcgcgcactaccgcgcgctggtgcacgaagacccgcagttcccggcc
tacttccgtgcggccacgccgattgacgtgatcgagcggctgcgcatcggctcgcgtccg
gccaagcgcgccggcagcggcgacatctcctcgttgcgcgcgatcccgtgggtgttcgcc
tggtcgcagaaccgagccgggctgaccgcgtggtacggcgtcggcaccggcctggccgcc
gcgctggaccgccacggtcgagacacgctggcggaaatggcgcgcgactggccgttcttc
ggcaccctcatcgacgatctggaaatggtgctggccaagtcggatccggcgatcttcgag
cgctactcgcagctcgcctcggcgttgccggacggcgacctgcacgcgcgtttccatccc
agcatcgccgccgagttcgaacgcacccgcgacgcggtgctggcgatcaagggcagcgac
gaactgctgcgcggcgatcaccgtttgcgccagtcgatccgcctgcgcaatccctacgtc
gacccgatcagcctgctgcaggtcgacctgctcgcgcgctggcgcgccgccgaccggccc
gacgacgcgctgctgcaggcgttggtggcgacggtcaacgggatcgcggcgggcgtgcag
aacaccggctga

DBGET integrated database retrieval system