KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_0163Help
Entry
Lepto7376_0163    CDS       T02361                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lep  Leptolyngbya sp. PCC 7376
Brite
Enzymes [BR:lep01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Lepto7376_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFY36608
UniProt: K9PU13
LinkDB All DBs
Position
185445..185996
Genome map
AA seq 183 aa AA seqDB search
MTNTIKLALVSTLTTLAFPAAAIAGSVTVTINLTSTQGIGPEVGKITLEDTGYGLILTPD
LENIVPGAHGFHVHKNPSCEPAEKNGTIVPGLAAGGHYDPLNSGYHGGPYEDGHLGDLPP
LYADKDGNSTIPVLAPRLNVANVLGRSLMIHFHGDNFSDDPKPLGGGGPRLACGVIPATI
PAS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgactaataccatcaaactcgctctggttagtaccctcaccacccttgcttttccggca
gcggcgatcgccggtagcgtaaccgttaccatcaacctcaccagtacccaaggcatcggc
cccgaagtaggcaaaatcaccttagaagatacaggctatggtctaatcctcactcctgat
ctagaaaatattgtgcccggagctcatggctttcatgtccataaaaaccctagctgtgaa
cccgcagaaaagaatggcacgattgtccctggtttagccgctggcggacattatgatcct
ctcaatagtggttaccatggtggcccctatgaagatggtcacttaggagatctgcctcct
ctttatgccgataaagatggtaacagcaccatacctgtccttgcaccacgcctgaatgtg
gcaaatgttctcggtcgttcactgatgatccatttccacggtgataacttctccgacgat
ccgaaacctctcggtggtggtggtccacgacttgcttgtggtgtaatccctgcgaccata
cccgcttcctaa

DBGET integrated database retrieval system