KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_0178Help
Entry
Lepto7376_0178    CDS       T02361                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
lep00630  Glyoxylate and dicarboxylate metabolism
lep00710  Carbon fixation in photosynthetic organisms
lep01100  Metabolic pathways
lep01120  Microbial metabolism in diverse environments
lep01200  Carbon metabolism
Module
lep_M00165  Reductive pentose phosphate cycle (Calvin cycle)
lep_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
lep_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lepto7376_0178
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lepto7376_0178
Enzymes [BR:lep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Lepto7376_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFY36623
UniProt: K9PU29
LinkDB All DBs
Position
204758..206173
Genome map
AA seq 471 aa AA seqDB search
MVQTKSAGFKAGVQDYRLTYYTPDYTPKDTDLLACFRMTPQAGVPAEECAAAVAAESSTG
TWTTVWTDGLTDLDRYKGRCYHVEPVAGEDNQYFCFVAYPLDLFEEGSITNVLTSLVGNV
FGFKALRALRLEDIRFPVAFIKTCPGNPHGITVERDLLNKYGRPLLGCTIKPKLGLSAKN
YGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETNEVKGHYLNVTA
ATCEEMIERAEFAKEIGTPIVMHDFITGGFTANTSLSKWCRKNGLLLHIHRAMHAVIDRQ
KNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGDRQGTLGFVDLMREDYVEEDRSRGVFF
TQDWASAPGTMPVASGGIHVWHMPALVDIFGDDSCLQFGGGTLGHPWGNAPGATANRVAL
EACVQARNEGRSLAREGNDVLREAGKWSPELAAALNLWKEIKFEFDTVDTL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggttcagaccaaatctgctgggtttaaggctggtgtacaagactatcgtctaacttat
tacacgcctgattacacacccaaagacactgatttactcgcttgtttccggatgactccc
caagctggagttcccgctgaagagtgtgctgcagctgttgcagctgagtcttctaccggt
acttggacaactgtatggactgatggtcttactgacctcgatcgctacaagggtcgttgt
taccatgttgagcctgttgctggcgaagacaatcagtacttctgtttcgtggcttaccct
ctcgacttgtttgaagaaggttcgatcacaaacgttttgacctctttggttggtaacgtt
ttcggttttaaagcgcttcgtgcacttcgcctcgaagatatccgtttccccgttgcattc
attaagacatgccccggtaacccccacggtattactgtagagcgtgaccttctcaacaag
tatggtcgtcctcttctcggttgtactattaagcctaagctcggtctttctgcaaagaac
tacggtcgtgcagtttatgagtgcctccgtggtggtcttgacttcactaaggatgatgag
aacattaactctcagcctttcatgcgttggcgtgatcgcttcctctttgttcaagaagcg
attgagaaagcacaagctgaaactaatgaagttaagggtcactacctcaacgtaactgcc
gctacttgcgaagaaatgattgagcgtgctgagtttgcaaaagaaatcggtactccgatt
gtcatgcacgacttcatcactggtggtttcactgcaaacactagtctttctaagtggtgt
cgtaagaatggtcttctccttcacattcaccgtgcaatgcacgctgtaattgaccgtcag
aagaaccatggtattcacttccgcgttcttgcgaagtgtctccgtctttctggtggtgac
cacctacactccggtactgtcgtaggtaagcttgaaggcgatcgccaaggtactcttggt
ttcgttgacctcatgcgtgaagactacgtggaagaagatcgttcacgcggtgtattcttc
acacaagattgggcgtccgcacctggtactatgcctgttgcttccggtggtatccacgta
tggcacatgcctgcactcgttgacatcttcggcgatgattcttgcctccagtttggtggt
ggtactttgggtcacccttgggggaatgctcctggtgcaactgcaaaccgtgttgcgctt
gaagcttgtgttcaagctcgtaacgaaggtcgtagcttggctcgcgaaggtaatgatgtc
ctccgtgaagcaggtaagtggtctcctgaattggctgctgctcttaacctgtggaaagaa
atcaagttcgaattcgacacagtcgacactctctaa

DBGET integrated database retrieval system