KEGG   Leptolyngbya sp. PCC 7376: Lepto7376_3252Help
Entry
Lepto7376_3252    CDS       T02361                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lep  Leptolyngbya sp. PCC 7376
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lepto7376_3252
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lepto7376_3252
   00680 Methane metabolism
    Lepto7376_3252
Enzymes [BR:lep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Lepto7376_3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3591121..3594111
Genome map
AA seq 996 aa AA seqDB search
MNQIMQPPSAEADILSSSQSLLRHRLSMVEDLWQAVLEKECDPQLVKRLKRLRESRSEDG
RIGDFLPEEISRLIESLSLEDAISAARAFALYFQLINSVEQHYEQREQQLSRRTIGNGDS
SGNGKATEEIEEIAPTQAGTFNWLFPYLKRQNMPPQKIQRLLNQMDIRLVFTAHPTEIVR
HTIRNKQRRIAGILRELDRMREGEAATDPTMSWEVDEIKQKLTEEIRLWWRTDELHQFKP
KVLDEVDYALHYFEEVLFEALPELSVRLQQAVKLSFPHTEVPLKNFCNFGSWVGGDRDGN
PSVTPDVTWRTACYQRGLVLERYIESIDQLADILSLSLHWSNVLPEILDSLEQEQTIFPD
IYDKLAIRYRQEPYRLKLAYIKRRLENTLDRNRRLANMPAWQNKVEVADERVYASGLDFL
ADLQLLKDSLVQTEIHCAALDKLICQVEIFGFVLTRLDFRQESTRHSDAIAEIVDYLGVM
DKSYNDLTDSEKVDWLVQELKTRRPLIPKEMDFSEKAIETIQTLQVLKRLQQEFGLGICQ
TYIISMTNEASDVLEVLLLAQEAGLYDPVAGTTTIRIAPLFETVDDLRNAPGIMKSLFDI
PLYRSCLSGGYNPPESGNFDEVFGDRLSPDLQEIMLGYSDSNKDSGFLSSNWEIHKAQKN
LQQVADPYGIDLRIFHGRGGSVGRGGGPAYAAILAQPPHTINGRIKITEQGEVLASKYSL
PDLALYHLESVSTAVIQSSLLVSGFDDIQPWNRIMEKLSQQSRAAYRSLVYEEPDFLDFF
MSVTPLPEISQLQISSRPARRKSGKKDLSSLRAIPWVFSWTQSRFLLPAWYGVGTALQEF
FEQDPEENLKLMRYFYSKWPFFRMVISKVEMTLSKVDLQMASHYVHELADPADHERFQPI
FDKISEEYKLTEKLVLQITENETLLDGDRPLQRSVQLRNGTIVPLGFLQVSLLKRLRQYT
RETKASIVHFRYSKEELLRGALLTINGIAAGMRNTG
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcatgcaacctcccagcgccgaagccgatattctctcctcatcacaatcc
ctcctgcggcatcgtctctcgatggtagaagacctttggcaagctgtcttagaaaaggag
tgtgatccgcagctcgttaagcgcctaaaacgattacgggagagtcgttcagaggatggt
cgtattggtgattttctccccgaagaaatttcccgactgatcgaaagtttgagtctagag
gatgcgattagtgcagcccgtgcttttgcgctttatttccaactaattaatagtgtcgag
caacattacgaacaacgggaacagcaactttcccgccggacgattggcaatggcgatagc
agtggcaatggtaaagcgacagaagagattgaagaaattgcaccaactcaagctggaacg
tttaattggctcttcccttatttgaagcgtcaaaatatgccgccccaaaaaatccagcgg
ctgctcaaccaaatggatattcgtctcgtttttactgcacaccctacggaaattgtgcgc
cacacgattcggaataagcagcgacgtattgctggaattttgcgtgaactcgatcggatg
cgagaaggagaagctgctacagatccgacgatgtcttgggaagtagacgagatcaagcaa
aaattgacggaagagattcgcctttggtggcgaactgatgagctacaccaattcaaacct
aaggtgttagatgaagtggactatgcactgcactattttgaggaagtgttgtttgaggca
ttgcctgagctttctgtacggttacagcaagctgtgaaattatcttttcctcacactgaa
gtccctctgaaaaatttctgtaattttggatcctgggtcggaggcgatcgcgatggtaat
ccctctgttacccctgatgtcacttggcgaactgcttgttatcaacggggacttgtttta
gagaggtatatcgaatccatcgatcagctagcagacattttaagtttgtctttgcactgg
agtaatgtgttgccagagattttggattctctagagcaagagcaaacaatcttcccagat
atttatgacaagctagcaatccgctatcgtcaagagccttatcgtttgaaattggcttac
attaagcgtcgcttggaaaatacgctagatcgaaatcgtcgtttagcgaatatgcctgct
tggcaaaacaaggtagaagttgctgatgagcgtgtctatgcgtctggtcttgattttctc
gcagatcttcagctattgaaagatagccttgtgcaaacggaaatccactgtgctgctctc
gataaattgatttgccaagtggaaattttcgggtttgtattaacccgccttgatttccgt
caagaatctacgcgccattctgatgcgatcgccgaaatcgttgattaccttggcgtaatg
gataagtcctacaacgacttaacggattccgaaaaggttgattggcttgttcaagaactc
aaaactcgtcgcccgctaattccaaaggaaatggatttttcggagaaggcgattgaaacg
attcaaactttgcaagttctaaaacgtctacaacaggaattcggcctcggtatttgccaa
acttacattattagtatgaccaacgaggcgagtgatgtcctcgaagtcttattgcttgcc
caggaagctggtttatacgaccctgtggctggcaccaccactattcggatagcaccgcta
tttgaaacggtggatgacctgcgaaatgcgccaggcattatgaagagcttgttcgatatt
ccgctctatcgatcttgtctctcgggtggttacaatccccctgaaagtggcaattttgat
gaagtgtttggcgatcgcctgtctccagatcttcaagagattatgttgggctattccgac
agtaataaagactctggtttcctcagtagtaactgggaaattcacaaagcccaaaagaat
ctccagcaagtcgctgatccttatggtattgacctccgaattttccatggtcgtggtggt
tccgttggtcgtggtggtggccccgcttatgccgcgattttggcgcaaccaccccacacc
attaatggtcgcatcaaaattacagaacaaggggaagtccttgcatcgaaatactccctt
ccagatctcgcgttatatcacctcgaaagtgtctctacagcagtcattcagtccagtctg
cttgtgagtggatttgatgatattcaaccctggaatcgcatcatggagaagctctctcag
cagtcccgggcggcgtatcgttctttggtttatgaggagcctgacttccttgatttcttt
atgtcagtaacgccactgccagaaattagtcagctccaaattagttctcgtcctgctcgc
cggaagtctggcaaaaaggatttgagtagtctacgagcaattccttgggtatttagttgg
acgcagagtcgtttccttttgcctgcttggtatggcgtgggtactgctttacaggaattc
tttgagcaagatcccgaagaaaacctcaagttgatgcgctatttctattcgaagtggccc
ttcttccgcatggtgatttcgaaagttgagatgacgctatcgaaggtggatctccaaatg
gcaagtcattatgtccatgagctagcggatcctgctgatcatgagcgtttccaaccgatt
tttgacaagatttcggaggagtataagctcacggaaaaactagtactccaaattactgaa
aatgagacactactcgatggcgatcgccctctccagcgttcggttcagttgagaaatggc
actattgttcctctcggctttttgcaggtttctctcctaaaacgcttgcgccaatatacc
cgcgaaaccaaagcaagtattgtccacttccgttacagcaaagaagagttattacgaggt
gctttgttaactattaacggtattgcggctggtatgagaaatacaggctga

DBGET integrated database retrieval system