KEGG   Leptolyngbya sp. O-77: O77CONTIG1_00648Help
Entry
O77CONTIG1_00648  CDS       T04251                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
let  Leptolyngbya sp. O-77
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:let00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O77CONTIG1_00648 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O77CONTIG1_00648 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    O77CONTIG1_00648 (ppc)
   00680 Methane metabolism
    O77CONTIG1_00648 (ppc)
Enzymes [BR:let01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     O77CONTIG1_00648 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
710013..713108
Genome map
AA seq 1031 aa AA seqDB search
MSSILHSSDDAFSTGTATEDRDDQPLSATDLFLRHRLKLVEELWESVLQQECGQQLVDLL
QQLRLVCSPEGQAPEEGEAIALAVIEKLDLNDAIRAARAFALYFQLINIVEQHYEQRGQQ
QQYRASYDVATASDDKQNGSDTQTAGLSADMLERSLREETALRREMSTFRGLFPKLANLN
VPPRQIQNLIDNLDIRLVFTAHPTEIVRHTIRDKQRRIAKILRQLDTAEDSMRMLGLTSS
WETETLREQLTEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDVIPHLYYRFRSAL
KATFPGLHPPRYNFCKFGSWVGSDRDGNPSVTPEITWKTACYQRNLVLAKYIQSVKHLIN
LLSLSLHWSDVLPDLLESLEQDQAQMPEVYEQLAIRYRQEPYRLKLSYIQKRLENTCERS
RKLYNGDYFNDESPDYNPATLYRSGDEFLADLQLIRRNLEETGLTCRDLENLICQVEIYG
FNLAHLDIRQESGRHSDAIAEIAEYLQILPKSYHEMTEEERSHWLATELKTRRPLIPSEL
PFSEKTCETIQTFRMVRKLHQEFGPAICQTYVISMSHHASDLLEVLLLAKEAGIYDPATG
SGAINVVPLFETVEDLLRAPAVMKELFELPLYRAYLSGGYAERQQEETGQKVDIAGSRST
LPQRASLQEIMLGYSDSNKDSGFLSSNWEIHKAQQSLQAMAETYGISLRIFHGRGGSVGR
GGGPAYEAILAQPGRSIDGRIKITEQGEVLASKYNLPELALYNLETITAAVVQASLLRNG
FDDIQPWHEIMEELATRSRSHYRSLIYEQPDFVDFFHQVTPIEEISQLQISSRPARRGGK
KDLGSLRAIPWVFSWTQTRFLLPSWYGVGTAINEFLQEEPEENLKLLRYFYYKWPFFKMV
ISKCEMTLSKVDLQIANHYVQQLSQPEDRERFERLFEQIRDEYHLTKGLVLAIAGHERLL
DGDPDLQRSVQLRNSTIVPLGFLQVSLLKRLRQHKTSAASGVIRSRYSRGELLRGALLTI
NGIAAGMRNTG
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atgagttccatcctccactcgtcggatgatgccttcagcaccggcaccgccacagaagat
cgagacgatcagcctctttcagctacggatctgtttcttcgccatcggctgaagctagtt
gaagaactgtgggagtcagtgcttcagcaagagtgtgggcagcagttggtagacctattg
cagcaactgcgcttggtctgctcccctgaaggacaagcccccgaagagggggaggcgatc
gccttagcggtcatcgagaagcttgatttaaacgacgcaattcgtgccgcccgtgctttt
gccctttattttcagctgatcaatatcgtcgaacagcactacgaacagcgtggacagcag
cagcaatatcgcgcctcctacgacgtagccacagcctccgacgacaagcaaaacggctcc
gacacccaaactgccggactcagtgctgatatgctagagcgcagcctgcgagaagaaacc
gcactgcgccgagaaatgagtacgtttcggggtctgtttcccaagctggccaaccttaac
gtgccgccacgccaaatccaaaacctgatcgacaaccttgacattcgcctcgtcttcact
gcccaccccacagaaatcgtccgccacaccatccgcgacaaacagcgccgcatcgccaaa
atcctgcgccagctcgacactgccgaagacagtatgcggatgctggggctgacttcttcc
tgggaaacggaaaccctgcgagaacagttgaccgaagaaattcgcctgtggtggcgcacc
gacgagttgcaccagttcaaaccaacggtgctagatgaagtagactacgcgctgcactac
ttccaagaagtcctgtttgatgtgattccgcacctttactaccgcttccgttcggcgcta
aaggccacctttccagggttgcatccgccccgctacaacttctgcaagtttggctcctgg
gtcgggtctgaccgcgacggcaacccgtccgtcaccccggaaatcacctggaaaaccgcc
tgctatcagcgcaatctggtgctggcgaaatacatccagtcggtgaagcacttgatcaac
ctgctgagcctgtcgctgcactggagcgatgtcttgcccgacctgctagagtcgctagag
caagaccaggcgcaaatgcctgaagtctatgagcagcttgccatccgctatcgacaggaa
ccctatcgcctgaagctgagctacatccaaaagcggctggaaaacacctgcgaacgcagc
cgcaagctctacaacggcgactatttcaacgacgagtctccggactacaacccggcgacg
ctctatcgctccggtgacgagtttctggcagatctacagttgattcgcaggaatcttgag
gaaacggggctaacctgccgtgatttagagaatttgatttgtcaggtggaaatttacggc
tttaacctggcgcatctggacattcgccaggagagcggtcgccactcggatgcgatcgcc
gaaatcgcggaatacctgcaaattctgcccaagtcttaccacgagatgacggaggaggag
cgatcgcactggctggccaccgagctaaaaacccgtcgcccgctaatcccgtcggaactg
cctttctccgaaaaaacctgcgaaaccatccaaaccttccgcatggttcgcaagctgcat
caagagtttggccccgcgatttgccagacctacgtcatcagcatgagccaccacgccagc
gacctgctggaagtgctgctcctggcaaaagaggcaggcatctacgaccccgccacgggc
agcggcgcaatcaacgtagtgccgctgtttgaaacggtagaagacctgctccgcgctccg
gcagtgatgaaggagctatttgagctgccgctctatcgggcatatctgtcgggcggctat
gccgagcgccagcaagaagagacagggcaaaaggtggatattgcaggctccaggagtacg
ctgccgcagcgagcctcactccaggaaatcatgctgggctattccgacagtaataaagac
tccggcttcctcagcagcaattgggaaatccacaaggcccagcagtcgttgcaagcgatg
gccgaaacctacggtatctccctccggatcttccacgggcgcggcggttccgtggggcgc
ggcggtgggccggcctatgaagcgattctggctcagccgggtcgcagcatcgacggccgc
atcaaaattacagaacaaggcgaggtgttggcctcgaaatataacctgccggaactggcg
ctgtataacctagaaaccatcacggcggcggtggtgcaggcgagcctgctgcgaaacggg
ttcgacgatatccagccgtggcacgaaattatggaggaactggcgacgcgatcgcgctcc
cactaccgctccttgatctacgaacagccggattttgttgatttcttccaccaggtcacg
ccgattgaagaaatcagccagcttcaaattagctcccggcccgctcggcgcggcggaaaa
aaagacctgggcagcctgcgggccattccctgggtgtttagctggacgcagacgcgcttc
ctgctgccctcctggtatggcgtgggcacggcgattaacgaattcctgcaagaggagcca
gaggaaaacctgaagctgttgcgctacttctattacaagtggcccttctttaagatggtg
atttccaaatgcgaaatgaccctttcaaaggtagacttgcagattgctaaccattacgtt
cagcagttgtcgcagcccgaagatcgggagcgcttcgagcggctatttgagcaaatccgc
gacgaatatcatctgacgaaggggctagtgctggcgatcgccggccatgagcgcctgctc
gatggcgaccccgacctccagcgctcggtgcaactccgcaacagcacaatcgtgcccctt
ggcttcctgcaagtctccctgctgaagcgcttgcgccagcacaagaccagcgccgcctct
ggcgtaatccgttcgcgctatagccggggcgaactgctgcgcggcgcactgctcaccatc
aacggcatcgccgccggaatgcgaaacacaggctga

DBGET integrated database retrieval system