KEGG   Leptolyngbya sp. O-77: O77CONTIG1_01322Help
Entry
O77CONTIG1_01322  CDS       T04251                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
let  Leptolyngbya sp. O-77
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:let00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    O77CONTIG1_01322 (cbbL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    O77CONTIG1_01322 (cbbL)
Enzymes [BR:let01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     O77CONTIG1_01322 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1468075..1469505
Genome map
AA seq 476 aa AA seqDB search
MSYSQTKTQAKAGYQAGVKDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVRGEDNQFIAYIAYPLDLFEEGSVTNMLTS
IVGNVFGFKALKALRLEDLRIPVAYLKTFQGPPHGIQVERDKINKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFTFVAEAIHKAQAETGEIKGHY
LNVTAATCEEMLKRAEYAKELNMPIIMHDFLTAGFTANTTLSKWCRDNGVLLHIHRAMHA
VIDRQKNHGMHFRVLAKCLRMSGGDHIHTGTVVGKLEGDKAVTLGFVDLLRENYIERDPS
KGIYFTQDWASMPGVMAVASGGIHVWHMPALVEIFGDDAVLQFGGGTLGHPWGNAPGATA
NRVALEACLQARNEGRDLMREGGDIIREACRWSPELATACELWKEIKFEFEAVDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttattcgcaaaccaagacccaggcaaaagctgggtaccaggctggggttaaggac
taccgcctgacttactacacccccgactacacgcccaaagacacggacattctggccgcc
ttccgggtcacccctcagcccggtgtgccgcccgaagaagcgggtgcagccgttgcggct
gagtcctcgactggcacctggacgaccgtgtggactgacctgctaactgacctcgatcgc
tacaagggtcgttgctacgatatcgaacccgttcgcggtgaagacaatcagttcatcgcc
tacattgcctaccctctggatctgtttgaagaaggctctgttaccaacatgcttacctcc
attgtggggaacgtatttggtttcaaagctctgaaggccctgcgattggaagacttgcga
atccctgtagcctacctcaagactttccagggaccgccccacggcatccaggtcgagcgt
gacaagattaataagtacggtcgtcccctgctgggctgcaccatcaagcctaagctgggt
ctgtcggcaaagaactacggtcgtgcagtgtacgagtgtctgcgcggcggtctggacttc
accaaagacgacgaaaacatcaactctcagcccttccagcgctggcgcgatcgcttcacc
ttcgtcgctgaagctatccacaaggcacaagctgagactggtgaaatcaaggggcactac
ctcaatgtgaccgccgccacctgcgaagaaatgctgaagcgggctgagtatgcgaaagaa
ctcaatatgcccatcatcatgcatgacttcttgaccgcaggcttcacagctaacactact
ctctccaagtggtgccgcgataacggtgtcttgctgcatatccaccgtgccatgcacgct
gtgatcgaccgccagaagaatcacgggatgcacttccgcgtactggcaaaatgcttgcgg
atgtccggtggtgaccacatccacaccggaaccgtggtgggcaagctagaaggcgacaaa
gccgtgacgcttggctttgtggatctcttgcgtgaaaactacatcgagcgtgacccctca
aagggcatctacttcacccaggactgggcctccatgccgggtgtgatggcagttgcttct
ggcgggattcacgtctggcatatgcccgcgctggtggaaatcttcggcgacgatgccgtg
cttcagtttggcggcggcacgctgggtcacccctggggcaacgcacctggtgcaacggca
aaccgtgttgctctggaagcctgcttacaagctcgcaacgaaggtcgcgacctgatgcgc
gaaggcggcgacatcatccgcgaagcttgccgctggtcgcccgaactggctaccgcttgc
gaactgtggaaggaaatcaagttcgagtttgaggcggtggataccgtctga

DBGET integrated database retrieval system