KEGG   Lysobacter enzymogenes C3: GLE_3698Help
Entry
GLE_3698          CDS       T04371                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
lez  Lysobacter enzymogenes C3
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lez00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    GLE_3698 (ligD)
Enzymes [BR:lez01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GLE_3698 (ligD)
DNA repair and recombination proteins [BR:lez03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     GLE_3698 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4162892..4165528)
Genome map
AA seq 878 aa AA seqDB search
MSLHEYRRKRRFDRTREPEPGAPPRGERAIFVVQLHHASRRHYDFRLQVGDALKSWAVPK
GPSYDPAVKRMAVEVEDHPLGYAGFEGEIPHGEYGGGHVARFDTGVWATDGDPQAQLAKG
HLRFELFGRKLKGGWHLVRSGKPARQPQWLLFKDRDEYAGTLEADDLLADVASPPAADAQ
RAGRGKPRKRRLAEVAPARARRRDWAAAARKLPGARRAPFDGGAFELQLARLVEAPPPGE
QWLHELKWDGYRIGVGVAAGRARLWSRNALEWTRKIPEIAAAVEALGLDSAALDGELIAG
RGAREDFNLLQATLSGEKQGALSLVVFDLLHLDGWDLSAAPLLQRKALLEQLLQRAGPHL
RYSSHILGEGERAYALADEQGFEGIVSKRADRAQHPGRSDEWRKSKRLASDEFAVVGYTP
PKGARSGFGALLLARPDPAHGWSYAGRVGSGFSADLLARISKRLPRGAAAPTVHVPPHDT
DLRAARWFAPALVVEAFYRGVGGHGLLRQASFKTLREDKTPAALADRDRGPGAAARLRSN
SNSNSGPPPKRTAMTRKAAKASAGKAKAGKTRTGKSQAAADLDDFRLTSPERVVYPDIGA
SKRDVAAYYLAMADWLLPDIVDRPLSIVRCTQGAARPCFFQKHHTAGLDDVDSVSLEEES
GQRADYLVVRDLAGLMNLVQFNALEFHPWGATAQRPDRADRIVFDLDPGSGVPWTEVIAA
ARQLRSLLAKLELQSFVRTSGGKGLHVVVPLNPGCDWDLVKPFAHSFAETLAQMEPLKYI
ATATKKFRNGKIFVDYLRNGRGATSVASFSLRAREGAPVAMPLRWEELGRVKSGHAFDIR
SAQARVKRLRRHPWAGIDAVRQDLDRLAERLQRLRPDD
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcacgaataccggcgcaagcggcgcttcgaccgcacccgcgagcccgaaccg
ggcgcgccgccgcgcggcgagcgcgcgattttcgtcgtccagctgcaccacgccagccgc
cgccactacgacttccgcctgcaggtcggcgacgcgctcaagagctgggcggtgcccaag
gggccgtcctacgatccggcggtcaagcgcatggcggtggaagtcgaggaccacccgctc
ggctacgccggtttcgaaggcgaaattccccacggcgaatacggcggcggccacgtcgcg
cggttcgacaccggggtgtgggcgaccgacggcgatccgcaggcgcaactggccaagggc
cacctgcgcttcgaactgttcgggcgcaagctcaagggcggctggcacctggtgcgttcg
ggcaagcccgcgcgccagccgcaatggttgttgttcaaggaccgcgacgaatacgccggc
acgctcgaagccgacgatctgctcgccgacgtcgcctcgccgccggcggccgacgcgcag
cgtgccggccgcggcaagccgcgcaagcgccgcctggccgaagtcgcgccagcgcgcgcg
cggcgccgcgactgggccgcggcggcgcgcaagctgcccggcgcgcggcgggcgccgttc
gacggcggcgcgttcgagctgcagttggcgcgcttggtcgaagcgccgccgccgggcgaa
caatggctgcacgaactcaaatgggacgggtaccggatcggcgtcggcgtggccgccggc
cgcgcgcggctatggtcgcgcaacgcgctggagtggacgcggaagattcccgagatcgcc
gccgcggtcgaagcgctgggcctggacagcgcggcgctggacggcgaactgatcgccggc
cgcggcgcgcgcgaggacttcaacctgctgcaggcgacgctgtcgggcgagaaacagggc
gcgctgtcgctggtggtgttcgacctgctgcacctggacggctgggacctcagcgccgcg
ccgctgctccagcgcaaggcgctgctggaacaactgctgcagcgggccgggccgcatttg
cgctacagctcgcacatcctcggcgaaggcgagcgcgcctacgcgctggccgacgaacag
ggcttcgaaggcatcgtgtccaagcgcgccgaccgcgcccagcatcccggccgcagcgac
gaatggcgcaagagcaagcgactggccagcgacgagttcgccgtggtcggctacacgccg
ccgaagggcgcgcgcagcgggttcggcgcgttgctgctggcgcggccggacccggcgcac
ggctggtcctacgcggggcgcgtcggcagcggtttttccgccgacctgctggcgcggatc
agcaagcgcctgcccaggggcgccgccgcgccgacggtgcacgtgccgccgcacgacacc
gacctgcgcgcagcgcgctggttcgcgccggcgttggtggtcgaggcgttctatcgcggc
gtcggcggccacggcctgctgcggcaggcctcgttcaagacgttgcgcgaggacaagacg
cccgccgcgctggccgaccgcgaccgcggtccgggcgccgcggcccggcttcgctccaac
tccaactccaactccggaccgccaccgaagcgaaccgccatgacccgcaaggccgccaaa
gccagcgccggcaaggccaaagccggcaagacgcgcaccggcaagtcccaggctgccgcc
gatctcgacgacttccgcctcaccagccccgaacgcgtggtctatcccgacatcggcgcg
agcaagcgcgacgtcgccgcctactatctggcgatggccgactggctgttgccggacatc
gtcgaccggccgctgtcgatcgtgcgctgcacccagggcgcggcgcggccgtgcttcttc
cagaagcaccacaccgccgggctagacgacgtggacagcgtcagcctggaagaggaatcg
ggccagcgcgccgactatctggtggtgcgcgatctggccggactgatgaacctggtccag
ttcaacgcgctggagttccatccgtggggcgcgacggcgcagcggcccgaccgcgccgac
cgcatcgtgttcgatctcgaccccggcagcggcgtgccctggacggaggtgatcgccgcc
gcgcgccagttgcgctcgctgctggccaagctggaactgcagtcgttcgtgcgcacctcc
ggcggcaagggcctgcatgtggtggtgccgctgaaccccggctgcgactgggacctggtc
aaaccgttcgcgcacagcttcgccgagaccctggcgcagatggagccgctcaaatacatc
gccaccgcgaccaagaaattccgcaacggcaagatcttcgtcgactacctgcgcaacggc
cgcggcgccaccagcgtggcatcgttctcgctgcgcgcgcgcgagggcgcgccggtggcg
atgccgctgcgctgggaggaactgggccgggtcaagagcggccacgcgttcgacatccgc
tccgcgcaggcgcgggtcaagcgcctgcgccggcatccatgggcggggatcgacgcggtg
cgccaggacctggaccgcctggccgaacgcctgcagcggctgcggccggacgattga

DBGET integrated database retrieval system