KEGG   Lysobacter enzymogenes C3: GLE_4845Help
Entry
GLE_4845          CDS       T04371                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lez  Lysobacter enzymogenes C3
Pathway
lez00620  Pyruvate metabolism
lez00680  Methane metabolism
lez01100  Metabolic pathways
lez01120  Microbial metabolism in diverse environments
lez01200  Carbon metabolism
Module
lez_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lez00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GLE_4845 (ppc)
  Energy metabolism
   00680 Methane metabolism
    GLE_4845 (ppc)
Enzymes [BR:lez01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GLE_4845 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase NIPSNAP PEPcase_2 DinB_2
Motif
Other DBs
NCBI-ProteinID: ALN60186
UniProt: A0A0S2DNS3
LinkDB All DBs
Position
complement(5404058..5406820)
Genome map
AA seq 920 aa AA seqDB search
MTDSNDESLRAADPAADRAADFAPTDALLREDVKTLGALVGEILAEQRGQGFLDDVERLR
RAAIRRREAGEPVDALAAALADIDLEQAADLVRAFATYFQAVNLAERVHRIRRRRDYERS
GAGAQPGGLRDSLAALARQGVSAEEVAALLPRLRIEPVFTAHPTEAVRRALLEKERTIVE
CLVADIDRGRTPAERRADRERIRLALTASWQTAEAPAAKPSVADEFEHVGFYLSDVLYRV
LPVYYEVFEEALRETYGDAPALPDVLGFGTWVGGDMDGNPNVGADTVAATLAGQRALVLG
AYRRDLASLEELLSQSVHRVRVDDAVLAKVEDYRYLLPKAAALLKPRHADMPYRNLLGLM
SARLQATLDESVHGYPDAAAFLADIDLIERSLAAHQGAHAGGFAVRRLRRRAECFGFHLA
GLDLRQDSATHDAALAALLDQPEWAALDVAARAARLHRLLDGEAPPARPAAPAAQSTLEV
FRAVARLRPRFGARAFGPYIVSMSRSAADALAVLALARTAGCADDQGRVPLDVAPLFETV
DDLDAAADTLRALFADPVYRGHLRARGDRQVVMLGYSDSAKDGGMVASRWALQQTQIALT
ALAADSCVRIAFFHGRGGSISRGGGKTERAVIAAPRGSVDGYLRLTEQGEVIHRKYGIRA
LALRNLEQTSGAVLRATLRPRAPEPREAGWRGIAGRLALDAREHYRALVHEDPQFPAYFR
AATPIDVIERLRIGSRPAKRAGTGDISSLRAIPWVFAWSQNRAGLTAWYGVGTGLERALA
QHGRDALAEMARDWPFFGTLIDDLEMVLAKSDPAIFERYSRLAEALPEGDLHARFHPGIA
AEFERTRAAVLAIKGSDELLRGDHRLRQSIRLRNPYVDPISLLQVDLLARWRAADRPDDA
LLQALVATVNGIAAGVQNTG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagcaacgacgaatccttgcgcgcggccgacccggccgccgaccgcgcggcc
gatttcgcgcccaccgacgccctgctgcgcgaggacgtcaaaacgctcggcgccctggtc
ggcgagatcctcgccgagcagcgcggccagggttttctcgacgatgtcgagcggctgcgc
cgcgccgcgatccgccgccgcgaggccggcgagccggtcgacgcgctggccgcggcgctg
gccgacatcgacctggagcaggccgccgatctggtgcgcgcgttcgccacgtatttccag
gcggtcaacctggccgagcgcgtgcaccgcatccgccgccgccgcgattacgagcgcagc
ggcgccggcgcccagcccggcggcctgcgcgattcgctggcggcgctggcgcggcagggc
gtcagcgccgaggaagtggcggctctgctgccgcggctgcggatcgagccggtgttcacc
gcccatcccaccgaagcggtgcggcgcgcgttgctggagaaggagcgcaccatcgtcgaa
tgcctggtcgccgacatcgaccgcggccgcaccccggccgagcgccgcgccgaccgcgag
cgcatccgcctcgcgctgaccgcgagttggcagaccgccgaggcgccggcggccaagccc
agcgtcgccgacgagttcgagcacgtgggcttctatctgtccgacgtgctctaccgggtg
ctgccggtctactacgaagtgttcgaggaggcgctgcgcgaaacctacggcgacgcgccg
gcgctgccggacgtgcttggtttcggcacctgggtcggcggcgacatggacggcaatccc
aatgtcggcgccgacaccgtcgccgccacgctcgccggccagcgcgcgctggtgctgggc
gcgtaccggcgcgatctggcttcgctggaagaactgctgagccagtcggtgcatcgcgta
cgcgtcgacgacgcggtgctggccaaggtcgaggactatcgctacctgttgcccaaggcc
gccgcgctgctcaagccgcgccacgccgacatgccttaccgcaacctgctggggctgatg
tcggcgcggctgcaggcgacgctggacgaaagcgtgcacggctatcccgatgcggccgcg
ttcctggccgacatcgatctgatcgaacgcagcctggccgcgcaccagggcgcgcacgcc
ggcggcttcgcggtgcggcgcctgcgccggcgcgcggaatgtttcggtttccacctggcc
gggctcgacctgcgccaggactcggccacccacgacgccgcgttggcggcgttgctggac
cagcccgagtgggccgcgctcgacgtcgccgcgcgcgccgcgcgcctgcaccgcctgctc
gacggcgaggcgccgccggcgcgtccggccgcgcccgcggcgcagtcgacgctggaagtg
ttccgcgcggtcgcgcgcctgcgcccgcgcttcggcgcgcgcgcgttcggcccgtacatc
gtcagcatgagccgcagcgccgccgacgcgctggcggtgctggcgctggcgcgcaccgcc
ggctgcgccgacgaccagggccgagtgccgctggacgtggcgccgctgttcgagaccgtc
gacgacctcgacgccgccgccgacaccttgcgcgcgttgttcgccgacccggtctaccgc
ggccacctgcgcgcgcgcggcgaccgccaggtggtgatgctgggctattccgacagcgcc
aaggacggcggcatggtcgcctcgcgctgggcgctgcagcagacccagatcgcgctgacc
gcgctggccgccgacagctgcgtgcgcatcgccttcttccacggccgcggcggctcgatc
agccgcggcggcggcaagaccgagcgcgcggtgatcgccgcgccgcgcggttcggtcgac
ggctacctgcggttgaccgagcagggcgaggtgatccatcgcaagtacggcatccgcgca
ctggccctgcgcaacctggaacagaccagcggcgcggtgctgcgcgcgaccctgcgcccg
cgcgcgccggagccgcgcgaggccggctggcgcggcatcgccggccggctcgcgctcgac
gcgcgcgaacactaccgcgcgctggtgcacgaagacccgcagttcccggcctacttccgc
gccgccacgccgatcgacgtgatcgaacgcctgcgcatcggctcgcgtccggccaagcgc
gccggcaccggcgacatctcctcgttgcgcgcgatcccgtgggtgttcgcgtggtcgcag
aaccgcgccggactgaccgcctggtacggcgtcggcaccggcctggaacgcgccctggcg
cagcacggtcgcgacgcgctggcggagatggcgcgcgactggccgttcttcggcaccttg
atcgacgacctggaaatggtcctggccaagtccgacccggcgatcttcgaacgctactcg
cgcctggccgaagcgctgcccgaaggcgacctgcacgcgcgtttccacccaggcatcgcc
gccgaattcgaacgcacccgcgccgcggtgctggcgatcaagggcagcgacgaactgctg
cgcggcgaccatcgcctgcgccagtcgatccggctgcgcaatccgtatgtcgatccgatc
agcctgttgcaggtcgatctgctcgcgcgctggcgcgccgccgaccgccccgacgacgcg
ctgctgcaggcgttggtggcgacggtgaacggcattgcggcgggggtgcagaacaccggt
tga

DBGET integrated database retrieval system