KEGG   Leptospirillum ferrooxidans: LFE_2373Help
Entry
LFE_2373          CDS       T01809                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lfc  Leptospirillum ferrooxidans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lfc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LFE_2373
  Energy metabolism
   00680 Methane metabolism
    LFE_2373
Enzymes [BR:lfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LFE_2373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2461504..2463072
Genome map
AA seq 522 aa AA seqDB search
MPENFLRPVYHQSFLDRKIPTTMATQHPDNASAPYWKSNGEAFISTLDELEECFRSYTDI
GCQEYMWDWEGKYVDEGVVDKLFSSYHEYFQKYQLGKDVFLTFRLPNIWYEKGYRIARAY
IGILTFADLARDLGLNSPPVFEVILPMTDEAQKMLHLKTTFQKIARLKSQVFDEVPLEQE
TDSSYLQVIPLIEGVPQLTASHNILNEYAQIHEQAYGEKPPYIRPFIARSDPALNSGFIP
ATIAAKVALSEYYKFGKESGIGIYPIMGVGSLPFRGGLSPNTVPQFAEEYAGVRTVTLQS
AFRYDYPLEKVREAVHLLNRTLPFTTPLSYSEKEIREGERLATIFSEIYQKTVEEIADTI
NLVSEHIPSRRERRLHIGLFGYSRGIGQKRLPRAIGFTASLYSLGIPPELISLGRGIQQA
LSEGLEESLATFCRSLKEDVRQAGFYLNRENLRFLSSENTAWEMIAQDISIAESFFKIEL
GPVTIEHYLHRNIVSSIYFLLQENKNITPYLQDAAILRKSLG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaaaactttcttcgtccggtctatcaccagtcctttctggatcgaaagatcccc
acaaccatggcgacgcagcacccggacaatgcaagcgctccatactggaaatccaacgga
gaagcctttatcagcacactcgacgagcttgaggagtgctttcgcagttataccgatatc
ggctgccaggaatatatgtgggactgggaaggaaagtatgttgacgaaggggtggtagac
aaactcttttcctcatatcacgagtattttcaaaaatatcagctgggaaaggatgtcttt
ctcaccttcaggcttcccaacatctggtatgaaaaaggataccggatcgccagggcttac
attggcattctgaccttcgcggatctggctcgcgatctcggactgaactctcctcctgtt
tttgaagtgattttgccaatgacggacgaagcccagaaaatgcttcacctcaagaccacg
ttccagaagatcgcccgactcaaaagccaggtctttgacgaggttccgcttgaacaggag
acggattcttcctatctccaggtgatccccctcatagaaggcgtaccacagctgacggca
tcccacaacatactgaacgagtatgcccagatccatgaacaggcctatggggaaaagcct
ccctacattcggccgtttatcgcccgatccgatccagcactgaactccggattcattcct
gccacgatcgccgccaaggtcgccctctccgagtactataaattcggaaaagaatccggc
atcggcatttatcccatcatgggtgtcggttcactcccatttcgcggaggcctttcgccc
aataccgtcccccaatttgcggaggaatatgccggcgtccggacagtcacactccagtcg
gccttccgctacgactatcccctcgaaaaggttcgggaggcagtacaccttctgaacagg
acccttcctttcacaactcctctttcctattccgaaaaggaaatccgggagggggaacga
ctcgcgacgatcttttccgagatctatcagaaaacggtggaagaaatcgccgataccatc
aacctcgtatcggaacatatcccttccagaagggaacgacgcctgcatatcggcctgttc
gggtattccaggggaattggacaaaaacgtctcccccgagccatcggatttacggcatcg
ctctactccctggggatccctccggaactcatttctctcggcaggggaatccagcaggcc
ttgtccgaagggcttgaagaatccctcgccacattctgtcgctccctcaaggaagatgtg
cgtcaggcaggtttttatctgaacagggaaaatctcagattcctgtcttccgaaaacacg
gcatgggaaatgattgcccaggacatttccatagcggagtcattcttcaagatagagctg
ggaccggtgacgattgaacattatctccatcgcaacattgtttcgagcatttactttctc
ttgcaggaaaacaagaacatcaccccgtacctgcaagatgcggccattctcagaaaatcg
cttggctaa

DBGET integrated database retrieval system