KEGG   Leuconostoc gelidum JB7: C269_02420Help
Entry
C269_02420        CDS       T02322                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lge  Leuconostoc gelidum JB7
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lge00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    C269_02420
  Energy metabolism
   00680 Methane metabolism
    C269_02420
Enzymes [BR:lge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C269_02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(497748..499265)
Genome map
AA seq 505 aa AA seqDB search
MTQRKFPTIMGTQHPDNANAPFWDASQQPFISAYREMNEAFENFSELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKTNQIGRDKFLTFRFPNIWEEKGYSLMQAMTAILSSEDFAHDL
GFDQRPLFEAILPMAQRADQLLEMQILFEKLANFKSVEFTKTDKNTPYIEMIPLFEDFNT
QLHAPEILKEYLKLHEEHFGFRPKYLRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAK
EENIDIYPISGTGSAIFRGGLSPHRIDRYVTEFPGVRTATVQSAFRYDFPLADVQQAITE
LKEKLPNAEPLKISANDQKILAEVAEESARFYADTLDQLIPDMQPIFKAFPKRRDRRQHV
GVLGYSRSVDGIELPRAINFTGSFYSIGIPPEFIGFGRALANLNADHLSVFVRNYPSMKK
DFRELAGYINLDALEILKTQSPAWSEVEQDIMTLKAIFNLEIGPHNREQQQHAEIALQVV
QIKDGAPVATTALINRMAQLRHFLG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgaaaattccctactattatgggtacgcaacatcctgataatgcaaatgca
ccattttgggacgcctcgcaacaaccatttatcagcgcataccgtgagatgaatgaagct
tttgaaaattttagtgaattaaacgttgatgaatatatgtgggactgggaaggtaagcat
gccgatgcagctgtcatcgatcgcctatttagtaccgaatatgattacttcaaaacaaat
caaattggtcgtgataaatttctaactttccgcttccccaatatttgggaagaaaaaggc
tatagcttaatgcaagcaatgactgctattttaagttcagaggactttgcacatgatctt
ggatttgatcaacgtcctttgtttgaagcaatattgccaatggcacaacgtgcagaccag
ttgcttgaaatgcagatattgtttgaaaaattagccaactttaagtcagttgaattcaca
aaaactgacaaaaatacaccctatattgaaatgattcctctgttcgaggattttaatacc
caattacacgcgcctgaaattttgaaagaatatcttaagttacacgaagaacactttggt
tttcgaccaaaatatctgcgtgtattcttagcaggatccgactctgcgttaaccgccgga
tttatgagttcaatcacaggtaataaacttgccattgcaagattacatgagtttgcaaaa
gaagaaaatatcgatatttaccccatttctggtacaggttcagctattttccgtggtggc
ttatcaccacatcgcattgaccgatacgtcacagaattccccggtgtacgcaccgcgacc
gtacagtccgctttccgttatgattttccattggcagatgtacaacaagccatcacagag
ttaaaagaaaaactgccaaatgctgaaccattaaaaatttctgctaatgatcaaaaaatt
ctagcagaagtggctgaggaatctgctcgattttatgcagatacactggatcaattaatt
cccgacatgcagcctatcttcaaagcttttcctaagcgtcgtgaccgtcgccaacacgtt
ggcgttcttggttactcacgatcagttgatggcattgagctcccccgtgctattaacttt
acaggctcattttattcaattggtataccgcctgaatttattggctttggtcgtgcatta
gcaaatctaaacgctgatcatttatcagtttttgtccggaactatcctagcatgaaaaaa
gatttccgtgaattagcaggttatattaatttagatgctttagaaattttgaaaacccaa
agtcctgcttggtcagaggtagaacaagatattatgacactcaaagccatttttaatctt
gaaattggtcctcacaaccgtgaacaacaacaacacgcagaaattgcactacaagttgtt
caaatcaaagatggtgccccagttgctaccacagctttaatcaatcgtatggcacaactc
agacacttcttaggttaa

DBGET integrated database retrieval system