KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_210191Help
Entry
LOTGIDRAFT_210191 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:lgi00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    LOTGIDRAFT_210191
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LOTGIDRAFT_210191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 156 aa AA seqDB search
MSEIKAVCVLKGKDGVGEGVVHFTQQGPDAEVVVKGKLEKLQPGEHGFHIHELGDNTNGC
ISAGGHYNPFSKTHGGPTSDDRHVGDLGNVTANDGNVAEFTITDKQLKLTGPYSIIGRTV
VVHEKVDDLGKGGNDESLKTGNAGPRLACGVIGITK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagataaaagcagtctgtgttttgaaaggcaaggatggagttggcgaaggcgtt
gttcattttacacaacagggacctgatgcagaagtggttgtgaaagggaaattagaaaaa
ttacaaccaggagagcacggttttcatatccatgaacttggtgataatactaatggttgt
ataagtgctggtggtcattacaatccatttagtaaaactcatggaggtcccacatcagat
gatagacatgttggtgatctaggtaatgtaacagctaatgatggtaatgtggctgaattc
actattacagataaacaattaaaattaacaggtccttattctattattggtagaactgtt
gtggttcatgaaaaagttgatgacttgggaaaaggaggaaatgatgaaagcttgaaaact
ggtaatgcaggtccaagattagcttgtggagtaattggtattacgaagtaa

DBGET integrated database retrieval system