KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_215685Help
Entry
LOTGIDRAFT_215685 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lgi  Lottia gigantea (owl limpet)
Brite
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LOTGIDRAFT_215685
Peptidases [BR:lgi01002]
 Metallo Peptidases
  Family M2
   LOTGIDRAFT_215685
Exosome [BR:lgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOTGIDRAFT_215685
CD molecules [BR:lgi04090]
 Proteins
  LOTGIDRAFT_215685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 1247 aa AA seqDB search
MRWFHVLAFVAVIGTTKTQGSEQADAKKWLKEYNIVFGKILNNQVRAEYTYNTDITDEHQ
KEQVTANVEMAAFLKEASQNASSFNWKKFKDADIKRQMKKISDIGPSALKEHKKVEELNK
ALSDMQSIYSKATVFLQNKTMNLEPGLTELFASSRDYDLLTEGWKLWRDASGAKMKTLYQ
RMVELSNEGSKENGYHDTGAFWRTDYEDDNFQDTVEELLVQLKPIYTELHTYIRKKLKDL
YGADKFPKTGQIPAHILGNMWAQTWNNIYSLVIPYPNKPSVDVTDALKEQNFTATRMFRT
AEHFFKSIGLDAMPATFWNGSMIERPSDGRDVVCYAAAWDMGDGKDFRIKMCTDITMEDL
ITIHHEMGHVEYFLQYKDQPSVFRDGANPGFHEAIGDTIALSVSTPKHLRKIGLLPAGEN
DYEADINYLMKIALEKIAFLPFGYLIDQWRWSVFSGETTPDNYNRKWWDLRCKYQGISPP
VKRTEEDFDPGAKYHVAANVPYIRYFISFVIQFQFHQSLCREANQTGPLHTCDIYNSLQA
GTKLKNMLKLGSSVQWQDAMELITGQRKMEVGPLLEYFKPLMEWLEKKNGGDGESWTDNC
PDPSSGGISDLEQADKFLDMYNERDSEIWFQSSELSWAYNTNLTDYNAQRKTEYSLKTAN
FAKEVAANASMFDWENFHNETRKRQFSFVAQLGTSAMKDVAKLKRVSTIRSLEVENEMES
VYSKGKVCLSGHTECMSLEPGLTRLLRSSSNYSELTEVWEGWRDATGPKIRPLYQQFVEL
SNEGYRAAGYNDTSEAWISNYETENFKEDLQELLEQLKPLYQQLHTYVRGKLIEKYGKEH
FPSSGHIPAHLMGNMWAQTWSNIFPLLEPYPGKGDVDVTPEMLNQNYTVERMFRTAEEFF
LSLGLKKMPNSFWNKSMLQKPTDGRDVVCHASAWDFGNTKDFRIKMCTDITMEDLITIHH
EMGHIQYYLQYKDQPTVFRGGANPGFHEAVGDVLAISVATPRHLNKIGLLPNLKEDNETD
LNFLMSLALDKIAFLPFGYLIDQWRWSVFRGQTPPDEYNRQWWDLRCKYQGISPPTKRTE
DDFDPGAKYHVPANTPYIRYFVSFVIQFQFHKALCQAANHTGPLYKCDIYQSKEAGQKLA
NMLSLGTSKPWPEAMEAITGQRKMDVRPLVEFFTPLLDWLEKQNSGKKFGWSDECPTGTD
GKIRDLDAARKWLKQYDNMATDVRFKSVEAEYTYSTNITKYNSGLKV
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtttcacgtattggcatttgtggcagtgataggaaccaccaaaactcaaggc
agtgagcaggctgatgcaaagaaatggttaaaagaatataatattgtatttgggaagata
cttaataaccaagttcgggcggaatacacctataacaccgatattacagatgaacatcaa
aaggaacaggttacagccaatgttgaaatggcagcattcctcaaggaggcttcacaaaat
gcttcttcttttaattggaagaaatttaaagatgctgacatcaaaaggcagatgaagaaa
atttcagatatagggcccagtgctcttaaagaacacaagaaggtcgaagagttaaacaaa
gctctttctgacatgcagtccatctacagtaaagctactgtttttctacagaataaaacc
atgaatctggaaccaggtctaactgaactgtttgcgtcatcacgtgattatgatctgctg
acagaaggctggaaattatggcgagatgcttctggtgccaaaatgaagacactatatcaa
agaatggtggagcttagtaatgaagggtccaaagaaaacggctatcacgatactggagcg
ttctggagaactgactacgaagacgacaattttcaggacacggtcgaggaacttctggtg
cagttgaaacctatctacactgaactacatacctatattagaaagaaactgaaggatttg
tacggtgcagataaatttccaaaaactggccaaattccagctcatattttaggtaacatg
tgggcacagacgtggaataatatctacagtttggtaataccctacccaaataaaccaagt
gtagacgttactgacgctctaaaagaacagaatttcactgctacccgaatgttccgaact
gccgaacatttctttaagtccattggcttagacgccatgccagccacattttggaacgga
tcaatgatagaaaggccatcagatggaagggatgtcgtctgctacgctgcagcttgggat
atgggagatggcaaagacttcagaatcaaaatgtgtacagatataacaatggaagatttg
atcaccatccatcacgagatgggtcatgttgaatatttcttacaatataaagatcaaccg
agtgtattccgagacggggccaatccaggtttccacgaagccattggagataccatagct
ctgtctgtttcaactccaaaacatcttcgtaagattggtctgttacctgctggggaaaac
gattatgaagctgatatcaattacttaatgaaaatagcattagagaagatcgcctttctg
ccatttgggtatctgatagaccaatggaggtggagtgtttttagtggagaaactacacct
gataactataacaggaaatggtgggatctcagatgtaaataccagggtatatcaccaccg
gtaaaaagaacagaagaggattttgatcctggagcgaaatatcacgtagctgctaatgta
ccctatatcagatattttataagttttgtaatccagttccagtttcaccaatcgctatgt
cgggaagccaatcaaacaggtccactacacacgtgtgatatttacaactctttacaggct
ggtaccaaactcaagaatatgttgaaactgggtagttctgtacaatggcaagatgcaatg
gaactgataacaggacagaggaagatggaggtgggcccattattagagtatttcaaaccg
ttgatggaatggttggagaagaagaacggtggggatggagaaagttggactgataactgc
cctgatccttcatctggtggcatcagtgatctcgagcaggccgataagtttttagatatg
tataatgaaagagatagtgaaatttggtttcaatcttcagaactctcctgggcttacaat
accaacctcactgattataacgcacagcgaaagaccgagtacagcttaaaaaccgctaac
tttgctaaagaggttgctgccaacgcttctatgtttgattgggaaaactttcataatgag
accagaaagagacaattttcatttgtggcacaactggggacgtctgctatgaaggatgtt
gccaagctaaaacgagtaagtactatccgatcattagaagtagaaaatgaaatggagtca
gtttacagcaaaggaaaagtttgtttaagtggacacacagaatgtatgagccttgaacca
ggcctaactcgcctgttgaggagttctagtaactacagtgagctgacagaagtatgggaa
ggttggagagatgctacagggcctaagatcagaccactttatcaacaatttgtagaactg
agtaatgaaggctatagagctgccggttacaacgatacatccgaggcgtggattagcaat
tatgaaactgagaattttaaagaagatctacaagaattattagaacaactcaaacctctg
tatcaacaacttcatacctacgttagaggaaagttaatagaaaaatatggaaaagaacat
tttccttccagtggtcatatccctgctcatttaatgggaaatatgtgggcacagacctgg
tctaatatatttcctctactggaaccgtaccctggaaaaggtgatgtcgatgtcacccca
gaaatgttgaaccagaactatacggttgaaagaatgtttagaactgcggaggaatttttt
ctgtcacttggtttgaagaaaatgcctaacagtttttggaataagtccatgttacaaaaa
cctacagatggacgtgatgtggtatgccatgcttcagcctgggatttcggtaacaccaaa
gattttagaatcaagatgtgtacagatataacaatggaggatctgataaccatccatcac
gagatgggacacatccagtattaccttcaatataaagatcaaccgacagtcttcagaggt
ggggccaatccagggttccatgaagctgttggggatgtgctggctatatcagtagctact
ccgcgtcacctcaataaaattggattgttaccaaacttgaaagaagacaatgaaacggat
ttaaacttcctgatgagtttagctctggataagattgccttcctaccatttgggtattta
atagaccaatggaggtggagtgtttttaggggtcagacgccacccgacgagtacaacaga
caatggtgggacttgagatgtaaatatcaaggaatatcaccaccaacaaaaagaacagaa
gacgattttgatcctggagctaaataccatgttcctgccaacactccatatatcagatat
tttgtaagtttcgtgatccagtttcagttccataaagctctatgtcaggccgccaaccat
actggacctctgtataaatgtgatatttaccagtctaaagaagccgggcagaaattagca
aatatgctgagtcttggaacttccaaaccatggccagaggcaatggaagcgattacagga
caacgtaaaatggacgttaggcctttagtggagttttttacgccgctgctggattggctc
gagaaacaaaacagcgggaagaagttcggttggtcagatgaatgtccgactggaacggat
ggtaagattagagatttggatgctgcccggaagtggttaaaacaatacgacaatatggcg
actgatgttagatttaaatcagtagaagcggagtacacttatagcaccaatataactaaa
tataacagtggactaaaggtatga

DBGET integrated database retrieval system