KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_231723Help
Entry
LOTGIDRAFT_231723 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
lgi  Lottia gigantea (owl limpet)
Brite
Enzymes [BR:lgi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     LOTGIDRAFT_231723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 743 aa AA seqDB search
MGSGASKPRRPGSAGSITRETYHNTHSALNPPTYRYRYVASYGDKLSKDPKKKDNVLQVE
KVDYNIRQNTPRHNTDLFEITQDDETPDPQLVVRRGTPFDITLTFNKPYDKNNDDLRLVF
ETGDKPLPNKKTHVEFVLSDEDKPKEWGGKVKRQDRNNLEITIFTPPTCYVAKWDFKVDV
VKKSDTKSSIFRYTHKDPIYILFNPFSKEDTVYKETDLKEYILNENGRIYSGTYKNISPK
PWNFGQFQGKVLDCVMHLLDISGLNWVCRGNPIQVVRKLTSMINAPDDGGVLVGNWSGDY
RGGKSPLTWTGSEAIFEEYYNTDRPVKFGQCWVFSGVLTTACRALGIPARSVTNFASAHD
TDGSVSIDIHFDHLGEPDETKNSDSVWNFHVWNEVWMARNDLPTGYGGWQAADATPQETS
DGVYCCGPASLEAVKNGELAYAFDGPFIFAEVNADKIYWTTELDGTMINNHTEKKSVGRK
ISTKYPLRPEREDVTHLYKYAEGSEEERTAVLRANQTGSCRHDIYAMGPQDVEFELEQQD
DVYVGQDFDVIFKIKNTSRNTERYITGRLSCRSMYYTGVGADKIKTDTFELFVPPGEVRE
QKLHIEADEYMNKLKDMCMLKFSAMAKVQGTEQVFTTQEDFRLCKPSLVVKVPNEIKKGK
SFDVEVSFTNPLGESMTECYLEVEGPGLLKRKQYPQRNVKPKQTFVTKFELTPKKLGEKE
ILVMFNSKQLEDVTATTVVNVKN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtggtgcgagtaaaccccgaagaccagggtctgctgggtcaataacaagagaa
acatatcataatacacacagtgctttaaacccacctacctatcggtataggtatgtggcc
agttatggcgataaactttcaaaagacccaaagaagaaagataatgtactacaagtagag
aaggtggactataatattcgacagaatacaccacgacataacacagatctgttcgagata
acccaggatgatgagacgcctgatccacaactggtcgtcaggagagggacacccttcgat
atcactctcacctttaataaaccttatgataaaaacaacgatgatttaagactagtgttt
gaaacaggagataaacctctgccgaacaaaaagacccacgtggagtttgtgttatccgat
gaggacaagcctaaagaatggggtggtaaagtaaaaagacaagacagaaacaatctagaa
atcactatttttactccaccaacctgttatgtggctaaatgggattttaaagtggatgta
gtcaagaaatccgacactaaatcctctatatttagatatactcataaagatccaatctat
attctctttaatcccttcagtaaagaggacacagtgtacaaagaaactgatctgaaagaa
tatattttaaatgaaaatggtagaatttactctggtacctataaaaacatcagcccaaaa
ccttggaactttggtcagttccaaggaaaggtattggattgtgttatgcatctgttagat
atatctggtttaaactgggtttgtcgtggcaatccaattcaggtcgttagaaaattaacg
tccatgatcaatgctccagatgatggtggtgtattggtgggcaactggtctggagattac
aggggaggtaaatcacctctaacatggacgggatcagaagctatcttcgaggaatactac
aatacagatagacctgttaaatttggtcagtgttgggttttctcgggtgtattgaccaca
gcatgtagagcactgggaataccagctagaagtgtcaccaactttgcctcggctcacgat
acggatggtagtgtttctattgatatccattttgaccacctaggtgaaccagatgagacc
aaaaactcggattcagtttggaatttccacgtatggaatgaggtatggatggctagaaat
gatttgccaacaggttatggaggatggcaagcggctgatgccacacctcaagaaacaagt
gatggtgtgtactgttgtggacctgcatcattagaagcagtcaaaaatggcgaattagca
tatgcttttgatggtccatttatctttgctgaagtaaacgctgataagatctactggaca
actgagttagatggtaccatgatcaacaaccataccgagaaaaaaagtgttggacgcaaa
atcagcaccaagtatccattacgaccagaacgagaagatgtaactcatctttataaatat
gctgaaggttcagaagaagagagaactgctgtattgagagctaatcaaactggatcttgt
cgacacgatatttatgcaatgggaccacaggatgtagaatttgagcttgaacaacaagac
gatgtttatgttggtcaagattttgatgtaatatttaaaatcaagaataccagcaggaac
acagagcgatatataactggtagacttagctgtagatctatgtattatactggagtcggc
gctgataaaattaaaaccgatacgtttgaactgtttgttccaccaggagaagtcagagaa
cagaagctccatatagaagctgatgaatacatgaataaattaaaagatatgtgtatgttg
aaattttctgctatggccaaggttcagggtacagaacaagtgttcaccacacaagaagac
ttcagattgtgtaagccgtctctagttgtcaaggtaccaaatgagatcaagaagggtaaa
tcgtttgatgttgaagtatcattcaccaacccgttaggtgagagtatgacagaatgttac
ctggaggtagaaggacctggattactcaaaaggaaacaatatccacagaggaatgttaaa
cctaaacagacctttgttaccaagtttgaattgacaccaaagaaacttggtgaaaaagaa
atccttgttatgttcaactcaaaacaacttgaagatgtcactgctactacagttgttaat
gtaaaaaattag

DBGET integrated database retrieval system