KEGG   Laribacter hongkongensis: LHK_02416Help
Entry
LHK_02416         CDS       T00884                                 

Gene name
kgd
Definition
(GenBank) Kgd
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lhk  Laribacter hongkongensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lhk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LHK_02416 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    LHK_02416 (kgd)
   00380 Tryptophan metabolism
    LHK_02416 (kgd)
Enzymes [BR:lhk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     LHK_02416 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2305239..2308058)
Genome map
AA seq 939 aa AA seqDB search
MMQAAISHSYLFGGNAPFIEELYEQYLDDPATVSAEWREYFDKLQQTGGATRDVPHQPIQ
ESFIQLAKTPRVFVNKPSEATWEAMQKQVAVLKLISAYRVLGSRWATLDPLKRMDTQPVP
ELDPAYHGLTDTDMAQVFNTGSFVGLASGSLSEILGTLKQTYCGNIGLEYMHIIDSKQKR
WVQNYFEGSRSTPRYDAAKKRSILKQVTAAETLERYLHTKYVGQKRFSLEGGESMIAALD
HLIQNATGFGVKELIVGMAHRGRLNVLVNTLGKLPRDLFSEFEGRPAVELPSGDVKYHMG
YSSDIPTQNGPMHVSLAFNPSHLEIVNPVVEGSVRARQQRRRDTERREVVPVLIHGDAAF
GGLGVNQGTFNLSGTRGYGTGGTLHFVVNNQIGFTTSDTRDMRSSMYATDIAKMVDAPIF
HVNGDDPEAVCFVMQAALEFRMQFKKDVVVDMVCFRKLGHNEGDDPMLTQPMMYKKIVQH
PGVRARYVERLVQEGSIDASEADSLISAYRAALDKGEHVEQTVLSNYTREFKLDWTPYIG
THWAHPTDTTLPTADLQRLADKLTTVPEGFKLHPTVSKLLAARREMAAGNQAVDWGMAET
LAYASLVESGYGVRLSGEDSGRGTFSHRHSVLHDQNRERWDAGAYVPLRNLSDNQAEFLV
IDSILNEEAVLAYEYGYACSSPKELTIWEAQFGDFANGAQVAIDQFIVSGETKWGRLCGL
TMILPHGYDGQGPEHSSARVERYLQLCAEHNVQVVMPSTAAQMFHVLRRQMLRPYRKPLI
IPMSKRLLRYKESMSPLADFTSGGFKPVIGEIEALDAKKVKRVVLCAGQVYYDLLNARRE
RDIQDIAIVRVEQLYPFPTEQLAAELAQYTNARELMWVQEEPKNQGAWYQIRHRLERQLA
PKQTLLFAGRPSSASPAVGYMSKHVAQLKAFLEEAMTLG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagctgctatcagccattcctatctgttcggcggaaatgcgccgttcatcgaa
gagctgtacgagcaatacctcgacgatccggcgacggtttctgccgagtggcgcgaatat
ttcgacaaactgcaacagaccggcggtgccacccgcgacgtgccgcaccagccaatccag
gaatcgttcatccagctggccaagacgccgcgcgtgttcgtcaacaagccgtccgaagct
acctgggaagccatgcagaagcaggtggccgtgctcaagctgatcagcgcctatcgcgtg
cttggcagccgctgggccacgctggacccgctcaagcgcatggatacccagccggtaccc
gaactggacccggcctatcatggcctgaccgataccgacatggcccaggtcttcaatacc
ggttccttcgtcggtctggcttccggctccctgtccgaaatcctcggcacgctcaagcag
acctactgcggcaacatcggccttgagtacatgcacatcatcgacagcaagcaaaagcgc
tgggtgcagaactatttcgaaggcagccgttcgaccccgcgttatgacgcagcgaaaaaa
cgcagcatcctcaagcaggtcactgctgccgaaacgctggaacgctacctgcataccaaa
tacgtcggccagaagcgtttctcgctggaaggcggcgaatcgatgattgccgcgctggat
cacctgatccagaacgccaccggcttcggcgtcaaggaactgatcgtcggcatggcccac
cgcggccgcctcaacgtactggtcaacaccctgggcaagctgccgcgcgacctgttctcc
gaattcgaaggccgtccggccgtcgagctgccgtccggcgacgtgaagtaccacatgggt
tactccagcgacattccgacccagaacggtccgatgcacgtgtcgctggcgttcaacccg
tcgcaccttgaaatcgtcaatccggtggtggaaggctcggtgcgtgcgcgccagcagcgc
cgccgcgacaccgagcgccgagaagtggtgccggtgctgatccacggcgatgccgccttc
ggcggcttgggcgtcaaccagggcaccttcaacctgtctggcacccgtggctacggcacc
ggcggtaccctccacttcgtggtcaacaaccagatcggctttaccacctcggacacccgc
gacatgcgctcgagcatgtacgccaccgacatcgccaagatggtcgatgcgccgattttc
cacgtcaacggtgacgatccggaggccgtgtgctttgtcatgcaggcggcactggaattc
cgcatgcagttcaagaaagacgtcgtggtcgacatggtgtgcttccgcaagctggggcac
aacgaaggcgacgatccgatgctgacgcagccgatgatgtacaagaagattgtccagcat
cccggcgtgcgcgcccgctacgtcgaacgtctggtgcaggaaggcagcattgatgccagc
gaagccgacagcctgatttcggcctatcgcgccgccctcgacaagggcgagcatgtcgag
cagaccgtgctgtccaactacacccgcgaattcaagctcgactggaccccgtacatcggc
acccactgggcgcatccgaccgataccacgctgccgacggccgacctccagcgtctggcc
gacaagctgaccacggtgcccgaaggcttcaagctgcacccgacggtatcgaagctcctg
gcggcccgccgcgaaatggcggccggcaaccaggctgtcgactggggcatggccgaaacg
ctggcctatgcctcgctggtcgaatccggctacggcgtgcgcctttccggtgaagattcc
ggtcgcggcactttcagccatcgccactcggtattgcacgaccagaaccgcgaacgctgg
gatgccggtgcctacgtgccgctgcgcaacctgtcggacaaccaggccgaattcctcgtg
atcgactcgatcctgaacgaggaggccgtgctggcctacgaatacggctatgcctgctcg
tcgccgaaggaactcaccatctgggaagcccagttcggtgacttcgccaacggtgcccag
gttgccatcgaccagttcatcgtctcgggtgaaaccaagtggggtcgcctgtgcggcctg
accatgatcctgccgcacggctacgacggccagggaccggagcactcctcggcccgggtc
gagcgttacctgcaactgtgtgccgaacacaacgtccaggtcgtgatgccgtcgacggcc
gcgcagatgttccatgtgctgcgccgccagatgctgcgtccgtatcgcaagccgctgatc
atcccgatgagcaagcgcctgctgcgctacaaggaatcgatgagcccgctggccgacttc
acctcgggcggtttcaagccggtcattggtgaaatcgaggcgctggatgccaaaaaggtc
aagcgcgtcgttctgtgtgccggtcaggtgtattacgatctcctcaatgcccgccgcgaa
cgtgacatccaggacattgccatcgtgcgtgtcgagcaactgtatccgttcccgaccgag
cagctggccgccgaactggcgcagtacaccaatgcccgcgagctgatgtgggtgcaggaa
gagccgaagaaccagggcgcgtggtaccagatccgtcaccgcctcgagcgccagctggca
ccgaagcagaccctgctgtttgccggccgtccgtcgtcggcctcgccggcagtcggttac
atgagcaagcatgtcgcccagctcaaggccttcctcgaagaagccatgacccttggttaa

DBGET integrated database retrieval system