KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_04935Help
Entry
JL53_04935        CDS       T03402                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00473  D-Alanine metabolism
lio00550  Peptidoglycan biosynthesis
lio01100  Metabolic pathways
lio01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lio00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    JL53_04935 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JL53_04935 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    JL53_04935 (ddl)
Enzymes [BR:lio01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JL53_04935 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lio01011]
 Precursor biosynthesis
  Amino acid ligase
   JL53_04935 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AIS62112
UniProt: A0A097BBR4
LinkDB All DBs
Position
1023865..1024977
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLNKFEAQPIYITNEGEWIQGPLLSGKLDF
VEQLRFAAADKVELALVETEKSAGELISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAAIPQVPAVAVRLIDWKNFQDEMVTEMEEVL
EYPVFVKPANLGSSVGISKATNKQELTEAMTEAFLYDRRVVVEQGVIAREIEMGVLGNDT
PICSVPGEILPEGAVAKFYDYKAKYQDNNTALIIPTEVEPEILAQMKEYAIQAFLGLDAS
GLVRADFFLTDDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYPALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaattttattatacggtggaaaatccgcagaacatgaggtttcttta
caaacggcattttctgtaattaatgcactagatttaaataaatttgaagcacaaccaata
tatattacaaacgaaggggaatggatacaaggcccactcctttctgggaaattagacttt
gtggagcaattgcgttttgcggcagctgataaagtggaacttgctttagtagaaacggag
aagtcggcgggagaacttattagcccagctgttttagaagcagatggacaagagactgtt
gtgttcccattgttacatggaccaaacggagaagacggtacagtacaaggattatttgaa
gtattaaatatcccttatgttgggaatggtgtgcttgcttcatcagcggcaatggataaa
atcgttatgaaaaagatctttgcagatgcagcgattcctcaagttccagcagtagctgtt
cgtttgattgactggaagaactttcaggatgaaatggttaccgaaatggaagaagtacta
gaatacccagtttttgttaaaccagcaaatcttggttctagtgttggtattagcaaggcg
accaataaacaagagctaacggaagcgatgactgaagcatttttatatgatcgtcgtgta
gtagtagagcaaggtgtaattgctcgtgaaattgaaatgggcgtacttggaaatgataca
cccatttgttccgtaccgggtgaaattttgccagaaggcgctgtggcaaaattttatgat
tataaagcgaagtatcaagacaataatactgcgcttattatcccgacagaagtagagcca
gaaattttagcacaaatgaaggaatatgctattcaagcgttcttaggtttagatgcaagt
ggacttgttcgtgctgatttctttttaacagatgataatcaattattcttaaatgaagtg
aatacgatgccaggatttacgccttatagtatgtatccacttttatggcaagaaacagga
ttaccttatccggccctaattgaacgactggttgatttagcaaaagaacgtcatgcagca
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system