KEGG   Lawsonia intracellularis PHE/MN1-00: LI0261Help
Entry
LI0261            CDS       T00354                                 

Gene name
gad
Definition
(GenBank) glutamate decarboxylase isozyme
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00250  Alanine, aspartate and glutamate metabolism
lip00430  Taurine and hypotaurine metabolism
lip00650  Butanoate metabolism
lip01100  Metabolic pathways
lip01110  Biosynthesis of secondary metabolites
lip01120  Microbial metabolism in diverse environments
lip02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LI0261 (gad)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI0261 (gad)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI0261 (gad)
   00430 Taurine and hypotaurine metabolism
    LI0261 (gad)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LI0261 (gad)
Enzymes [BR:lip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LI0261 (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CAJ54317
UniProt: Q1MRQ9
LinkDB All DBs
Position
complement(324064..325572)
Genome map
AA seq 502 aa AA seqDB search
MATARKAVVKKMPVGHGTKRGSMGNRTQKSSMSNGVVRHELLDDVFAEDDLSQTLPKYQM
PLYEHRPRDIYQAVHDELMLDGNARQNLATFCQTWVDPEIHKLMDECVAKNMIDKDEYPQ
TAELEMRCVNMLADLWNSPDPTNTIGCSAIGSSEAAMLGGMALKWRWRAQRKKAGKSTDK
PNLVCGPVQICWHKFARYWDIELREIPMEKNRLIMSPEEAIKRCDENTIGVVPTLGVTYT
GQYEPVEEVSNALDALQKKKGWDIPIHVDAASGGFLAPFIEPELVWDFRLPRVKSINSSG
HKFGLAPLGMGWVVWREKTDLPEDLIFWVNYLGSNIPTFAINFSRPGGQIVCQYYNLLRL
GREGYRRIHQACYDTTDYLANELTKTGIFKILYGGKTGIPALTWTLKDEKKYPFSLYDLS
DRLRTRGWQVPAYSMPANRTDLVVMRVLVRHGFDHDLADLLVNDIHRAIEHLKQNPRRKP
LGSGQVTSYDHSGRSSIPQKKK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcaagaaaggctgtagtaaaaaaaatgcctgtggggcatggaacaaaaaga
ggatctatggggaataggacacaaaaatcatccatgagtaatggtgtggtacgtcatgaa
ttattagatgatgtttttgcagaagatgatcttagtcaaaccttacctaagtatcaaatg
ccactgtatgagcatagacctagagatatttatcaggctgttcatgatgagcttatgcta
gatggtaatgcacggcaaaatcttgcaacattttgtcagacttgggttgatcctgaaatc
cataaacttatggatgaatgtgttgctaagaacatgattgataaggatgaatatccacag
acagcagaactggaaatgcgctgtgtaaatatgttagctgatctttggaattccccagat
ccaacaaatacaataggatgttcagctattggttctagtgaagcagccatgcttggtggt
atggcattaaagtggagatggagggcacaaagaaaaaaagctggaaaatcaacagataag
cctaacttagtatgtggacctgtacaaatctgttggcataaatttgctcgctattgggat
attgagttacgtgaaattcccatggaaaaaaatagacttattatgtcaccagaagaagcc
atcaaacgctgtgatgaaaatacaataggcgtggtccctacattaggtgtaacatataca
ggtcagtatgaacctgtagaagaggttagtaatgcattagatgcattacaaaagaagaaa
ggatgggatattcccattcatgttgatgcagcaagtggaggatttcttgcaccatttatt
gagcctgagctagtatgggattttcgcttacctcgtgtaaaatctattaactcttcagga
cataagtttggacttgcacctttaggtatgggctgggttgtatggagagagaaaactgat
ttacctgaagatcttattttttgggtaaactatttaggaagtaatattcctacatttgct
attaatttttctagacctggaggacaaatagtttgtcaatattataacttacttcgctta
ggtcgtgagggatatcgtcgtattcatcaggcttgttatgatacaacagattaccttgcc
aatgagttgacaaagactggaatttttaaaattttgtatggtggtaaaacaggtatacca
gctttaacatggacacttaaagatgaaaaaaagtacccatttagtttatatgatctttca
gatcgtttaagaactcgtggatggcaagttccagcatattcaatgcctgctaatcggact
gatcttgttgtaatgagagtccttgttcgtcatggttttgatcatgatttagccgatctt
ttagtaaatgatatacatcgtgctattgaacaccttaaacaaaatccaagacgtaagcca
ttgggttcaggtcaagttacaagttatgatcactctggacgttcatctattcctcaaaaa
aagaaataa

DBGET integrated database retrieval system