KEGG   Lawsonia intracellularis PHE/MN1-00: LI0261Help
Entry
LI0261            CDS       T00354                                 

Gene name
gad
Definition
(GenBank) glutamate decarboxylase isozyme
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LI0261 (gad)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI0261 (gad)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LI0261 (gad)
   00430 Taurine and hypotaurine metabolism
    LI0261 (gad)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LI0261 (gad)
Enzymes [BR:lip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LI0261 (gad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(324064..325572)
Genome map
AA seq 502 aa AA seqDB search
MATARKAVVKKMPVGHGTKRGSMGNRTQKSSMSNGVVRHELLDDVFAEDDLSQTLPKYQM
PLYEHRPRDIYQAVHDELMLDGNARQNLATFCQTWVDPEIHKLMDECVAKNMIDKDEYPQ
TAELEMRCVNMLADLWNSPDPTNTIGCSAIGSSEAAMLGGMALKWRWRAQRKKAGKSTDK
PNLVCGPVQICWHKFARYWDIELREIPMEKNRLIMSPEEAIKRCDENTIGVVPTLGVTYT
GQYEPVEEVSNALDALQKKKGWDIPIHVDAASGGFLAPFIEPELVWDFRLPRVKSINSSG
HKFGLAPLGMGWVVWREKTDLPEDLIFWVNYLGSNIPTFAINFSRPGGQIVCQYYNLLRL
GREGYRRIHQACYDTTDYLANELTKTGIFKILYGGKTGIPALTWTLKDEKKYPFSLYDLS
DRLRTRGWQVPAYSMPANRTDLVVMRVLVRHGFDHDLADLLVNDIHRAIEHLKQNPRRKP
LGSGQVTSYDHSGRSSIPQKKK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcaagaaaggctgtagtaaaaaaaatgcctgtggggcatggaacaaaaaga
ggatctatggggaataggacacaaaaatcatccatgagtaatggtgtggtacgtcatgaa
ttattagatgatgtttttgcagaagatgatcttagtcaaaccttacctaagtatcaaatg
ccactgtatgagcatagacctagagatatttatcaggctgttcatgatgagcttatgcta
gatggtaatgcacggcaaaatcttgcaacattttgtcagacttgggttgatcctgaaatc
cataaacttatggatgaatgtgttgctaagaacatgattgataaggatgaatatccacag
acagcagaactggaaatgcgctgtgtaaatatgttagctgatctttggaattccccagat
ccaacaaatacaataggatgttcagctattggttctagtgaagcagccatgcttggtggt
atggcattaaagtggagatggagggcacaaagaaaaaaagctggaaaatcaacagataag
cctaacttagtatgtggacctgtacaaatctgttggcataaatttgctcgctattgggat
attgagttacgtgaaattcccatggaaaaaaatagacttattatgtcaccagaagaagcc
atcaaacgctgtgatgaaaatacaataggcgtggtccctacattaggtgtaacatataca
ggtcagtatgaacctgtagaagaggttagtaatgcattagatgcattacaaaagaagaaa
ggatgggatattcccattcatgttgatgcagcaagtggaggatttcttgcaccatttatt
gagcctgagctagtatgggattttcgcttacctcgtgtaaaatctattaactcttcagga
cataagtttggacttgcacctttaggtatgggctgggttgtatggagagagaaaactgat
ttacctgaagatcttattttttgggtaaactatttaggaagtaatattcctacatttgct
attaatttttctagacctggaggacaaatagtttgtcaatattataacttacttcgctta
ggtcgtgagggatatcgtcgtattcatcaggcttgttatgatacaacagattaccttgcc
aatgagttgacaaagactggaatttttaaaattttgtatggtggtaaaacaggtatacca
gctttaacatggacacttaaagatgaaaaaaagtacccatttagtttatatgatctttca
gatcgtttaagaactcgtggatggcaagttccagcatattcaatgcctgctaatcggact
gatcttgttgtaatgagagtccttgttcgtcatggttttgatcatgatttagccgatctt
ttagtaaatgatatacatcgtgctattgaacaccttaaacaaaatccaagacgtaagcca
ttgggttcaggtcaagttacaagttatgatcactctggacgttcatctattcctcaaaaa
aagaaataa

DBGET integrated database retrieval system