KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1398Help
Entry
LIV_1398          CDS       T01623                                 

Gene name
sod
Definition
(GenBank) Putative superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Brite
Enzymes [BR:liv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LIV_1398 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1463533..1464141)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVSGHAELASKPVEELVAN
LDSVPEEIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNNGKLEIISTANQDSPLSEGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattaccaaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaacaatggaaattcactatacaaagcaccacaatacttatgtaacaaaactaaat
gaagcagtctcaggacacgcagaacttgcaagtaaacctgtggaagaattagttgctaat
ctagatagcgttcctgaagaaattcgtggcgcagtacgtaaccacggtggtggacatgct
aaccatactttattctggtctattcttagcccaaatggtggtggtgctccaactggtaac
ttaaaagcagcaatcgaaagcgaattcggcacatttgatgaattcaaagaaaaattcaat
gcggcagctgcggctcgttttggttcaggatgggcatggctagtagtgaacaatggtaaa
ctagaaattatttccactgctaaccaagattctccacttagcgaaggtaaaactccagtt
cttggcttagatgtttgggaacatgcttattatcttaaattccaaaaccgtcgtcctgaa
tacattgacacattttggaatgtaattaactgggatgaagcaaataaacgctttgacgca
gcaaaataa

DBGET integrated database retrieval system