KEGG   Lotus japonicus: Lj1g3v4955350.1Help
Entry
Lj1g3v4955350.1   CDS       T04348                                 

Gene name
Lj1g3v4955350.1
Definition
(Kazusa) -
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lja  Lotus japonicus
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:lja00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Lj1g3v4955350.1 (Lj1g3v4955350.1)
Enzymes [BR:lja01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Lj1g3v4955350.1 (Lj1g3v4955350.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
LinkDB All DBs
AA seq 152 aa AA seqDB search
MVKAVAVLGSSDNVKGTITFSQEGDGPTNVSGTISGLKPGLHGFHVHALGDTTNGCLSTG
PHFNPAGKEHGAPEDAIRHAGDLGNVTVGDDGTTSFSITDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggcagttcttggcagcagcgataatgtcaagggaactattaccttc
agtcaggagggagatggcccaactaacgtaagcggaactatttccggtcttaagcccggt
ctccatggcttccatgtccatgccttgggtgacaccaccaatggctgcttgtcaactgga
ccacatttcaatcctgcaggcaaggagcatggtgcccctgaggatgcgattcgtcatgct
ggtgatttaggaaatgtgactgtcggtgatgacggaaccacaagcttctctattactgac
agtcaaatccctctcactggaccaaactccatcataggaagggctgttgttgtccatgct
gatcctgatgatctcgggaaaggtggccatgagcttagcaagactactggaaatgctggt
ggcagagtagcttgtggtattattggtttacaaggataaacc

DBGET integrated database retrieval system