KEGG   Lactococcus lactis subsp. lactis KLDS 4.0325: P620_09450Help
Entry
P620_09450        CDS       T02882                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
lld  Lactococcus lactis subsp. lactis KLDS 4.0325
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lld00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P620_09450
Enzymes [BR:lld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     P620_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1841182..1842759)
Genome map
AA seq 525 aa AA seqDB search
MKNKLLLLSVTLLATCALSACQKANSKDSSVKKVAVSQKVDRSLYRNFYEIFTSSFADSN
HDGEGDLNGVTQHLDYLNTGKSNSTTDLKVQGLWMTPIFASPSYHGYDVTNYEKINPKFG
TMADFENLIAQAKKRGIAVILDMPFNHTATDNVWFQKALAGDKKYVAYYNWSDTAKEGYS
LASNGKYYESEFDKSMPDLNLANPEVKKEIAKITKFWLDKGVSGFRLDAVGFYFSNDDKK
TTAFTKWLTDTVKKQNPKAYLVGEVFSTASAIDDIYPSGIDSLFDFPNALQSSSSPINSA
LVLGEGSLFGQQIEAWDQEIHADNPKAIDAPFLSNHDTDRSATLLSSLSMQKMAAQTYLL
MPGNPFIYYGEELGLTGSGIDQNKRLPMPWNAAGTDSPKADISVPGATEIATTDGGSVAQ
QEANPNSLLNWYKKILRVKAKYPEIATDRLKNISVSEESLSVINYGKDLTIINNFSDTEN
VTMKLPKSVVGTKITDQLSISSSQAKLTDGKLTIPAYSTVILKKK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataagcttttacttctgtcagtaactttactggcgacgtgtgctttaagtgct
tgtcaaaaagcaaattcaaaagattcatcagtaaaaaaagtggctgtcagccaaaaggtt
gatagaagtttgtatcgtaatttttatgaaatatttacgagttcatttgccgattcaaat
catgatggcgaaggtgatttaaatggggtcacgcaacatttagactacttgaatactgga
aaatccaattctacaacggatttgaaagtgcaaggactttggatgacaccgatttttgct
agtcctagttatcatggctatgatgtcactaattacgaaaaaattaatcctaaatttggg
acaatggctgattttgaaaatctgattgctcaagctaaaaaacgaggaattgctgtgatt
ttagatatgccatttaaccacacggcaactgataatgtttggtttcaaaaagcactagct
ggcgacaaaaaatatgtggcttattataattggtcagatacagctaaagagggttatagt
ttagccagcaacggcaaatactatgagtcagagtttgataaatccatgccagacctcaat
cttgccaatcctgaggtcaaaaaagaaattgcaaaaattacgaaattttggttagacaaa
ggtgtttctggttttcgtttggacgctgtcggtttttatttctcaaatgatgacaaaaaa
acgacggcctttaccaaatggctgacagacacggtcaaaaagcaaaatccaaaagcctat
ttagtgggtgaagttttttcaacggcttcggcaattgatgatatttatccatcaggtatt
gattcattatttgactttccgaatgctttgcaatcgagttcaagtccaattaattcagct
ttagtcttaggtgaaggctctttatttggtcaacaaattgaagcatgggaccaagaaatt
catgcggataacccgaaagccattgacgctcctttcttgagtaatcatgacacagaccga
tctgcaacccttttaagttctttatccatgcagaaaatggctgctcaaacttatcttttg
atgccgggaaatccatttatttactacggtgaggaattggggctgaccggttctggcatt
gaccaaaataaacgtttgccaatgccgtggaatgctgctgggacagattctcccaaagca
gacatttctgtgccaggcgcgacagaaattgccacaactgacggaggctcagtagctcaa
caagaagccaatccgaactcactactcaattggtacaaaaaaattttacgggtcaaagca
aaatatcctgaaattgcgactgacagattgaaaaatatttctgtcagtgaagagagcttg
tctgtcattaattatggaaaggatttgactattatcaataatttttccgatacagaaaat
gtgacaatgaaactcccaaaaagcgttgttgggacaaaaatcactgaccaactttctatc
agtagttctcaagcaaaattaactgatggaaaattgacaattccagcttacagcaccgtt
attttgaaaaaaaaataa

DBGET integrated database retrieval system