KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1179Help
Entry
llmg_1179         CDS       T00475                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00250  Alanine, aspartate and glutamate metabolism
llm00430  Taurine and hypotaurine metabolism
llm00650  Butanoate metabolism
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    llmg_1179 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    llmg_1179 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    llmg_1179 (gadB)
   00430 Taurine and hypotaurine metabolism
    llmg_1179 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    llmg_1179 (gadB)
Enzymes [BR:llm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     llmg_1179 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAL97772
UniProt: O30418
LinkDB All DBs
Position
1147076..1148476
Genome map
AA seq 466 aa AA seqDB search
MLYGKENRDEAEFLEPIFGSESEQVDLPKYKLAQQSIEPRVAYQLVQDEMLDEGNARLNL
ATFCQTYMEPEAVKLMSQTLEKNAIDKSEYPRTTEIENRCVNMIADLWNASEKEKFMGTS
TIGSSEACMLGGMAMKFSWRKRAEKLGLDINAKKPNLVISSGYQVCWEKFCVYWDIEMRE
VPMDREHMSINLEKVMDYVDEYTIGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVY
IHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEEL
IFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMYLAEEIEK
TGMFEIMNDGAQLPIVCYKLKENSNRGWNLYDLADRLLMKGWQVPAYPLPKNLENEIIQR
LVIRADFGMNMAFNYVQDMQEAIDALNKAHILFHQEPENKTYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagaaaatcgagatgaagcggagttcttggaaccaatttttggttca
gaaagtgaacaagtggatttacctaaatataaattagctcaacaatcaattgagcctcga
gtggcctatcagttagttcaagatgaaatgctagatgaagggaacgctcgtttaaatttg
gccacattctgtcaaacttatatggaacctgaagcagtcaagctgatgagtcagaccttg
gaaaaaaatgcgattgacaaatcagaatatccaagaacaactgaaattgaaaaccgttgc
gtcaacatgatcgctgacctttggaatgcgagtgaaaaagaaaaatttatggggacttcg
acaattggttcttcagaagcttgtatgcttgggggaatggctatgaagttttcttggcgt
aagcgagcagaaaaattaggcctagatattaatgcgaaaaagccaaacttagtcatttcc
tctggttatcaagtttgctgggaaaaattctgtgtttattgggatattgaaatgagagaa
gtgccaatggatagagaacatatgtcaatcaatttggaaaaagtgatggattatgttgat
gaatatacgattggagtagttggaattatggggattacttatactggtcgttatgatgat
atcaaagctttggataatttgattgaagaatataataaacagacagactacaaagtttat
attcacgtagatgctgcttcaggaggactttatgctccttttgttgagccagaacttgag
tgggatttccgtttgaaaaatgtcatttcaatcaatacttcaggacataaatatggttta
gtatatcctggtgtaggttgggtcttgtggcgtgacaaaaaatatttacctgaagagtta
atttttaaagtaagttatcttggaggagaattaccaacaatggcgattaatttttctcac
agtgcttctcaattaatcggtcaatactataattttgtacgttatggatttgatggatat
aaagctattcatgagagaacgcataaagtagccatgtatttagcagaagaaattgaaaaa
acaggaatgtttgagattatgaacgatggggcacaattaccaattgtctgctacaaatta
aaagaaaattcaaaccgtggttggaatctttatgatttggcagatcgtttattaatgaag
ggatggcaagtgcctgcttatccacttcctaaaaatttggaaaatgaaatcattcaacgt
ttagtaattcgagcagatttcgggatgaatatggcatttaactatgttcaagatatgcaa
gaagcaattgatgcactaaataaggctcatattctatttcatcaggaacctgaaaataaa
acatatggctttactcactaa

DBGET integrated database retrieval system