KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1256Help
Entry
CVCAS_1256        CDS       T01964                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:llt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CVCAS_1256 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CVCAS_1256 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CVCAS_1256 (gadB)
   00430 Taurine and hypotaurine metabolism
    CVCAS_1256 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CVCAS_1256 (gadB)
Enzymes [BR:llt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CVCAS_1256 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1307139..1308539)
Genome map
AA seq 466 aa AA seqDB search
MLYGKENRDEAEFLEPIFGSESEQVDLPKYKLAQQSIEPRVAYQLVQDEMLDEGNARLNL
ATFCQTYMEPEAVKLMSQTLEKNAIDKSEYPRTTEIENRCVNMIADLWNASEKEKFMGTS
TIGSSEACMLGGMAMKFSWRKRAEKLGLDINAKKPNLVISSGYQVCWEKFCVYWDIEMRE
VPMDKEHMSINLDKVMDYVDEYTIGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVY
IHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEEL
IFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMFLAKEIEK
TGMFEIMNDGSQLPIVCYKLKEDSNRGWNLYDLADRLLMKGWQVPAYPLPKNLENEIIQR
LVIRADLGMNMAFNYVQDMQEAIEALNKAHILYHEEPENKTYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagaaaatcgcgatgaagcagagttcttggaaccaatttttggttca
gaaagtgaacaagtggatttgcctaaatataaattagctcaacaatcaattgaacctcga
gtggcctatcagttagttcaagatgaaatgttagatgaagggaacgctcgtttaaattta
gccacattctgtcaaacttatatggaacctgaagcagtcaaactaatgagtcaaaccttg
gaaaaaaatgcaattgataaatcggaatatccaagaacaactgaaattgaaaaccgttgc
gtcaacatgatcgctgacctttggaatgcgagtgaaaaagaaaaatttatggggacttca
acgattggttcttcagaagcttgtatgcttggtggaatggccatgaagttttcttggcgc
aagcgagcagaaaaattgggattagatattaatgcgaaaaagccaaacttagttatttca
tctggttatcaagtttgctgggaaaaattctgtgtttattgggatattgaaatgcgagaa
gtgccaatggataaagaacatatgtcaatcaatttggacaaggtgatggattatgttgat
gagtacacgattggtgtagttggtattatggggattacttatactggtcgttatgatgat
atcaaagctttggataatttaattgaagaatataataaacagacagactataaagtttat
attcacgtagatgctgcttcaggaggactttatgctccctttgttgagccagaacttgag
tgggatttccgtttgaaaaatgtcatttcaatcaatacctcaggccataaatatggttta
gtttatcctggtgtaggttgggttttgtggcgtgacaaaaaatatttaccagaagaatta
atttttaaagtaagttatcttggaggagaactaccaacgatggccattaatttttctcat
agtgcctctcaattaattggtcaatattataattttgtacgttatggatttgatggatat
aaagctattcatgagagaacacataaagtagccatgtttttagcaaaagaaattgaaaaa
actggaatgtttgaaattatgaacgatgggtcacaattgccaattgtctgctataaatta
aaagaagattcaaatcgaggttggaatctttatgatttggcggaccgtttattaatgaag
ggatggcaagtgcctgcttatccacttcccaaaaatttggaaaatgaaatcattcaacgt
ttagtgattcgagcagatcttgggatgaatatggcatttaactatgttcaagatatgcaa
gaagcaattgaggctttaaataaggctcatattctatatcatgaagagcctgaaaataaa
acatatggatttactcactaa

DBGET integrated database retrieval system