KEGG   Labilithrix luteola: AKJ09_08895Help
Entry
AKJ09_08895       CDS       T04033                                 

Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
Organism
llu  Labilithrix luteola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9351961..9353742
Genome map
AA seq 593 aa AA seqDB search
MASGAGSHHASRDPQKVPPTLAEAIRKLAHHEDRGFVFVRADGSERFCSFRELCIESEKR
AGDLHARGVKKGDRVAIVVPDPENFVLSFLGAVMGGVVPVPISPQLSFKNAETYHDTVAH
IVKASGASLLLTSSGTRQYVDPVLPRVDTLKAVLDVEEMGKVDHGKLDVTVDPTDLAFLQ
FTSGSTSRPKGVVVTHRNLAWNSQSFMIEGLEKDSSFDKGVSWLPLFHDMGLIGFVIGPL
FTDIPVVFLPTASFVRNPRVWLDKIHTHRGTITYAPNFAYQLVAKRVKEKDVGELDLSCL
RRAGCGAEPIQARTMREFAEKLAPAKFDPRAFLPSYGMAEATLAITFVPTMSGVRSDVIE
KAQLESGKATPREDRDALAEGAQELVNCGRSFPEHAIAVVDEQGNRLADRQVGQIITSGP
SVCAGYYNEPELTEAAFKKDENGIVWLYTGDLGYMVDGEVFICGRLKDMIIVRGRNFYPN
DIEWVVSELPGIRRGNVVAFGTEVNGEEQLVVAAEAFSSEAEGLRDVIAQAVNASFSLAA
HEVVIVPQGTLPRTSSGKPQRRKTKQMYLDGTLGRARSVQGTGSQPGEAGASA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggcgctggctcccaccatgcgagccgggacccccagaaggttcctccgacc
ctcgccgaagcgattcgaaagcttgcccaccacgaggaccgcggattcgtcttcgtacgc
gccgacggcagcgagcgtttctgctcgttccgtgagctttgcatcgaatccgagaagcgc
gccggcgacctccacgcgcgtggcgtgaagaagggcgatcgcgtcgcgatcgtcgtcccc
gatcccgagaacttcgtcctgtcgttcctcggcgcggtcatgggcggcgtcgttccggtg
ccgatctctccgcagctctcgttcaagaatgccgagacgtaccacgacaccgtcgcgcac
atcgtgaaggcctcgggcgcctcgctgctcctcacgtcgagcggcacgcgccagtatgtc
gatccggttcttccgcgcgtcgacacgctcaaggccgttctcgacgtcgaagagatgggc
aaggtcgatcacggcaagctcgacgtcaccgtcgacccgaccgacctcgcgttcctccag
ttcacctcgggcagcacctcgcgtcccaagggcgtcgtcgtcacgcaccgcaatctggct
tggaacagccagagcttcatgatcgagggcctcgagaaggactcctcgttcgacaagggc
gtgagctggctcccgctcttccacgacatggggctcatcgggttcgtcattggcccgctc
ttcacggacatcccggtcgtcttcctcccgacggcgagcttcgtccgcaacccgcgcgtc
tggctcgacaagatccacacgcaccgcggaaccatcacctacgcgccgaacttcgcctac
caactcgtcgccaagcgcgtgaaggagaaggacgtcggcgagctcgatctctcctgcctc
cgccgcgcaggctgcggtgcggagccgattcaggcgcgcacgatgcgcgagttcgccgag
aagctcgcgcccgcgaagttcgacccgcgcgcgttcctcccgtcgtacggcatggcggaa
gccacgctcgccatcaccttcgtcccgacgatgagcggcgtccgttcggacgtcatcgag
aaggcgcagctcgagtcgggcaaggccactccgcgcgaggatcgcgatgcgctcgccgag
ggcgcccaggagctcgtcaactgcgggcgttcgttccccgagcacgcgatcgccgtcgtc
gacgagcaggggaaccgcctcgccgatcgtcaggtcggtcagatcatcacgtcgggcccg
agcgtctgcgcgggctactacaacgagcccgagctcaccgaagctgccttcaagaaggac
gagaacggcatcgtgtggctctacaccggcgacctcggttacatggtcgacggcgaggtc
ttcatctgcggccgcctcaaggacatgatcatcgtccgcggccgcaacttctacccgaac
gacatcgagtgggtcgtcagcgagctgcccggaatccgccgcggcaacgtcgtcgcgttc
ggcaccgaagtgaacggcgaggaacagctcgtcgttgccgccgaggcgttctcctccgag
gcggaaggactcagggacgtcatcgcacaagccgtgaacgcgagcttttcgctcgctgcg
cacgaggttgtcatcgtcccacaggggaccttgccgcgaacttccagcggaaagcctcag
cggcggaagaccaagcagatgtatctggatggcacactcgggcgcgcacggagcgtgcaa
ggcaccggtagccagcccggtgaagccggcgctagcgcgtag

DBGET integrated database retrieval system