Lutra lutra (Eurasian river otter): 125108878 Help Entry 125108878         CDS       T08100                                  Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04140   Autophagy - animal llv05014   Amyotrophic lateral sclerosis llv05022   Pathways of neurodegeneration - multiple diseases llv05134   Legionellosis Brite KEGG Orthology (KO) [BR:llv00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125108878  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     125108878   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125108878    05022 Pathways of neurodegeneration - multiple diseases     125108878  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:llv04131]     125108878   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125108878    04031 GTP-binding proteins [BR:llv04031]     125108878 Membrane trafficking [BR:llv04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     125108878  Autophagy   Other autophagy associated proteins     125108878 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125108878   Exosomal proteins of other body fluids (saliva and urine)    125108878   Exosomal proteins of colorectal cancer cells    125108878 GTP-binding proteins [BR:llv04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     125108878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA AAA_7 PduV-EutP ABC_tran AAA_29 AAA_16 Septin AAA_22 LANC_like AAA_5 TniB CRAL_TRIO_2 Motif Other DBs NCBI-GeneID:  125108878 NCBI-ProteinID:  XP_047601220 LinkDB All DBs Position 9:58250832..58281429 Genome browser AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactct ggggttggaaagtcttgcctcctccttaggtttgcagatgatacatatacagaaagctac atcagcacaattggtgtggatttcaaaataagaactatagagttagatgggaaaacaatc aagcttcaaatatgggacacagcaggccaagaaagatttcgaacaatcacttccagttat tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aacgttaaacagtggctgcaggaaatagaccgttacgccagtgaaaatgtcaacaagttg ttggtagggaacaagtgcgatctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgctgattcccttggaattccatttttggaaaccagtgctaagaacgcaacgaat gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagca acagctggtggtgcagagaagtccaatgtgaaaattcagagcactccagtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system