KEGG   Listeria monocytogenes HCC23: LMHCC_0240Help
Entry
LMHCC_0240        CDS       T00801                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LMHCC_0240
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMHCC_0240
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMHCC_0240
   00430 Taurine and hypotaurine metabolism
    LMHCC_0240
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LMHCC_0240
Enzymes [BR:lmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMHCC_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(240597..241991)
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADHLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatataccctcggaaaagaaccactcgaacctcggattgcc
tatcgtttagtaaaagatgaacttttagatgaaggttctgcccgccaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaagttaatgtccgaaacactagaaaaa
aatgcgattgataaatccgaatatcctagaacagccgaactagaaaatcgttgcgtcaat
attatcgctgacttgtggcatgcacctaaagaccaaaaattcatgggaacttccacaatc
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcttctggc
tatcaagtatgctgggaaaaattctgtgtctactgggatatcgatatgcgcgttgttcca
atggataaagaccacatgcaactaaatactgaccaagtccttgattacgtcgacgaatat
acaatcggcgttgtcggcatcctcggcatcacttacacaggccgctacgatgacatctat
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gtcgatgcagcaagtggcggattcttcacaccatttgtcgaacccgatatcatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
ccaggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaactcatcttt
aaagttagctatcttggcggagaaatgccaaccatgcaaatcaatttctcccgcagcgcc
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaacaagcgatgtcgcacaataccttgctcatgcagtcgaacaaaccggc
tactttgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacgtaaaatggacattatatgatttagcggaccacctccaaatgcgcggctgg
caggttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgagctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgcccacattctcttccacgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system