KEGG   Listeria monocytogenes EGD-e: lmo1439Help
Entry
lmo1439           CDS       T00066                                 

Gene name
sod
Definition
(RefSeq) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lmo  Listeria monocytogenes EGD-e
Brite
Enzymes [BR:lmo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     lmo1439 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
complement(1472980..1473588)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVTN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPE
YIETFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattacctaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaaccatggaaattcactatacaaagcaccacaatacttatgtaacaaaactaaat
gaagcggttgctggtcatcctgaacttgcaagcaaatctgcggaagaattagttactaac
ctagatagcgttcctgaagatattcgcggcgctgtccgtaaccacggtggcggtcatgct
aaccatacattgttctggtctattcttagcccaaatggtggcggcgctccaactggcaat
ttaaaagcagcaatcgaaagcgaattcggtacttttgacgaatttaaagaaaaattcaat
gcagcagctgcagcacgttttggttctggttgggcttggctagtagttaatgatggcaaa
ttagaaatcgtttctacagctaaccaagattctccattaagcgatggcaaaacacccgtt
cttggcttagatgtttgggaacatgcttactaccttaaattccaaaaccgtcgtcctgaa
tatatcgaaacattttggaatgttattaactgggatgaagctaacaaacgctttgacgca
gctaaataa

DBGET integrated database retrieval system