KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_1411Help
Entry
LMOSLCC7179_1411  CDS       T02224                                 

Gene name
sodA
Definition
(GenBank) iron/manganese superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lmos  Listeria monocytogenes SLCC7179
Brite
Enzymes [BR:lmos01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LMOSLCC7179_1411 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1419622..1420230)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSAEELVTN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIETEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattacctaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaaccatggaaattcactatacaaagcaccacaatacttatgtaacaaaactaaat
gaagcggttgctggtcatcctgaacttgcaagcaaatctgcggaagaattagttactaac
ctagatagcgttcctgaagatattcgcggcgctgtccgtaaccacggtggcggtcatgct
aaccatacattgttctggtctattcttagcccaaatggtggcggcgctccaactggcaat
ttaaaagcagcaatcgaaaccgaattcggtacttttgacgaatttaaagaaaaattcaat
gcagcagctgcagcacgttttggttctggttgggcttggctagtagttaatgatggcaaa
ttagaaatcgtttctacagctaaccaagattctccactaagcgatggcaaaacacctgtt
cttggcttagatgtttgggaacatgcttactaccttaaattccaaaaccgtcgtcctgaa
tatatcgacacattttggaatgttattaactgggatgaagctaacaaacgctttgacgca
gctaaataa

DBGET integrated database retrieval system