KEGG   Listeria monocytogenes 07PF0776: MUO_04535Help
Entry
MUO_04535         CDS       T02040                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MUO_04535 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MUO_04535 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MUO_04535 (ddl)
Enzymes [BR:lmp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MUO_04535 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lmp01011]
 Precursor biosynthesis
  Amino acid ligase
   MUO_04535 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
889641..890753
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLEKFEAAPIYITNEGEWIQGPLLSGKLDF
VEQLRFSATDTIKLATTESEKSEGEAISPAVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAGIPQVPAVAVRLIDWKNYQAEMVAEMEEVL
TYPVFVKPANLGSSVGISKATNKKELADAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PVCSVPGEILPEGAVATFYDYKAKYQDNNTALIIPTEVDPEILEQMKEYAVQAFLGLDAS
GLVRADFFLTEDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYGALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaattaattttgttatacggtgggaaatctgctgaacacgaagtttcctta
caaacagcattttcagttatcaatgctttggatttagaaaaattcgaagctgcgccaata
tatattacgaatgaaggtgagtggattcaagggccacttctttctgggaagttagatttt
gtcgaacaattacgtttttcagctacagatacaataaaacttgcaacaactgaatcagaa
aaatcagaaggggaagcgattagcccggccgttttagaagcagacggacaagagacagtc
gtattcccgcttttacatggtccaaacggagaagatggcactgttcaaggattgttcgaa
gtattaaacattccatatgttggtaacggggtcttggcatcttctgctgcaatggacaaa
atcgtgatgaagaaaatctttgcagatgctggaatcccgcaagttccagcagttgctgtt
cgattaattgattggaagaactatcaagcggaaatggttgcggagatggaagaagtactt
acctatccagttttcgtaaaaccagcaaaccttggttcgagtgttggtattagtaaggca
acgaacaaaaaagaattagcggacgcaatgacagaagcatttttatatgaccgtcgtgtg
gttgttgaacaaggtgttgttgcgcgcgaaatcgaaatgggcgtacttggaaatgatacg
ccagtttgctctgttccgggtgaaattttgccagaaggtgcagttgctacgttttacgat
tacaaagcaaaataccaggataataatactgcgttaattattccgactgaagtagatccg
gaaatcttggaacaaatgaaagaatatgcggttcaagcattcctagggcttgatgcaagc
ggactagtgcgagcggactttttcttaacggaagataatcagttattcttaaatgaagtc
aatacaatgcctggtttcacaccgtacagcatgtatcctcttctttggcaggaaacgggc
ttaccgtacggagcgttaattgaacgattagtcgatttagcgaaagaacgccacgcagcc
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system