KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_3354Help
Entry
LPV_3354          CDS       T02174                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
Brite
Enzymes [BR:lph01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LPV_3354 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3452282..3452860
Genome map
AA seq 192 aa AA seqDB search
MTFTLPQLPYALDALAPHVSKETLEYHYGKHHNTYVTNLNKLIPGTEFESMTLEEIIMKA
KGGIFNNAAQVWNHTFYWHSMSPNGGGEPKGRLAEAINKSFGSFAAFKEQFSQTAATTFG
SGWAWLVQDQSGALKIISTSNAGTPMTEGLNALLTCDVWEHAYYIDYRNRRPDYIEAFWS
LVNWDFASSNLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaccctgccgcaattaccttatgcattggatgcactggcccctcatgtttcc
aaagaaaccttggaataccattatggtaaacaccataacacttacgttaccaacttaaat
aaattaattcccggaacagaatttgaatccatgactctggaagagatcatcatgaaagct
aaaggcggtatttttaacaatgcagctcaggtttggaatcacaccttttattggcacagc
atgagccctaatggtggaggtgagccaaaaggcaggctggcggaagccattaataaaagc
tttggctcttttgcagcattcaaagaacaattttcacaaacagctgctacaacattcggt
tccgggtgggcatggctagtccaggatcagtcgggggctttaaaaattatcagcacaagc
aatgctggaacaccaatgactgaaggattaaatgccttattaacttgtgacgtatgggag
cacgcctattacatcgattatagaaataggcgcccggattatattgaagccttttggtca
ttagttaactgggattttgcgagcagtaatctgaaataa

DBGET integrated database retrieval system