KEGG   Lactobacillus paracasei subsp. paracasei 8700 2: LBPG_01690Help
Entry
LBPG_01690        CDS       T02808                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lpi  Lactobacillus paracasei subsp. paracasei 8700:2
Pathway
lpi00473  D-Alanine metabolism
lpi00550  Peptidoglycan biosynthesis
lpi01100  Metabolic pathways
lpi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lpi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LBPG_01690
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LBPG_01690
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LBPG_01690
Enzymes [BR:lpi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LBPG_01690
Peptidoglycan biosynthesis and degradation proteins [BR:lpi01011]
 Precursor biosynthesis
  Amino acid ligase
   LBPG_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: EEQ66241
LinkDB All DBs
Position
complement(150612..151685)
Genome map
AA seq 357 aa AA seqDB search
MKIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDLFLGYDLEGKTVEQVFDDANT
SKDLNISDAILTDEDINKLRPDGSTQLFGPNVMAICKAADIVFLALHGGDGENGKVQAVF
DINGVKYTGSGPLASGITMNKVFSKEVMLYHGIQTSGFKEFKRDQGPKQTVPFDFPVVVK
PTSGGSSVGTHIIHNQEELESGLEDVFRFDNSAIVEEFTPGREFSLGVVNGHAYSAIEIK
VRSGWYDFKHKFQAGYTDFITPPKDLDEDVHQAMKDVAVQTMDVLGLQNYGRIDFFANEK
GVWVIEANNLPGMTPLSLLPQEAEADGVDYGDLVMDIVNGKLKLYADGMTEAGLLTK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgttttagcaggcggccggagcacggagcgcaatgtgtccatttctagc
ggctaccggatcacgaacgccttgcggcaaaaagggcagcaggccacctttattgacctg
tttcttggctacgacctcgaagggaagacggtcgaacaggtttttgatgacgccaacacc
agcaaggatctgaatatttcagatgcgattctgactgatgaagacatcaataagttacgg
ccagatggcagcacccagctatttggtcccaatgttatggcgatctgcaaagcagcggac
attgttttcctcgctttgcatggtggcgatggcgaaaacggtaaggttcaggctgtgttt
gacatcaacggggtcaagtatactggctctggcccgctggcttcaggcatcaccatgaac
aaggttttcagtaaggaagtcatgttgtatcatggcattcagacttcaggattcaaggaa
ttcaagcgcgatcaagggccaaaacaaacggtcccgtttgattttccagttgttgtcaag
ccaacatccggcggttccagcgttgggacacatattattcataatcaggaagaactcgaa
agtggtcttgaagatgttttccgcttcgacaacagtgccattgttgaagagttcacccca
ggtcgcgaattctcgttaggcgttgtcaatggccacgcttactcggccattgaaatcaag
gtgcgttctggttggtatgatttcaagcataaattccaagccggctacaccgacttcatc
accccgccaaaggatctcgatgaagatgtccatcaggctatgaaagatgttgccgtccaa
acgatggatgttctgggcctgcaaaattacggccgaatcgacttcttcgccaacgaaaaa
ggtgtttgggtcattgaagccaacaacctgccggggatgacaccactgtcactgttgccg
caagaagccgaagcagacggtgttgactacggcgatttggtgatggatattgtcaacggc
aagctcaagctctacgctgacggcatgaccgaggctggactcttaacgaagtaa

DBGET integrated database retrieval system