KEGG   Lactobacillus plantarum subsp. plantarum P-8: LBP_cg2780Help
Entry
LBP_cg2780        CDS       T02670                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lpr  Lactobacillus plantarum subsp. plantarum P-8
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LBP_cg2780
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LBP_cg2780
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBP_cg2780
   00430 Taurine and hypotaurine metabolism
    LBP_cg2780
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LBP_cg2780
Enzymes [BR:lpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LBP_cg2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2847395..2848804
Genome map
AA seq 469 aa AA seqDB search
MAMLYGKHNHEAEEYLEPVFGAPSEQHDLPKYRLPKHSLSPREADRLVRDELLDEGNSRL
NLATFCQTYMEPEAVELMKDTLAKNAIDKSEYPRTAEIENRCVNIIANLWHAPDDEHFTG
TSTIGSSEACMLGGLAMKFAWRKRAQAAGLDLNAHRPNLVISAGYQACWEKFCVYWDVDM
HMVPMDEQHMALDVDHVLNYVDEYTIGIVGIMGITYTGQYDDLAALDKVVTHYNRQHSKL
PVYIHVDAASGGFYTPFIEPQLIWDFRLANVVSINASGHKYGLVYPGVGWVVWRDRQFLP
PELVFKVSYLGGELPTMVINFSHSAAQLIGQYYNFIRFGMDGYREIQTKTHDVARYLAAA
LDKVGEFKMINNGHQLPLIYYQLAPREDREWTLYDLSDRLLMNGWQVPTYPLPANLEQQV
IQRIVVRADFGMNMAHDFMDDLTKAVHDLNQAHIVYHHDAAPKKYGFTH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttatacggtaaacacaatcatgaagctgaagaatacttggaaccagtcttt
ggtgcgccttctgaacaacatgatcttcctaagtatcggttaccaaagcattcattatcc
cctcgagaagccgatcgcttagttcgtgatgaactattagatgaaggcaattcacgactg
aacctggcaactttttgtcagacctatatggaacccgaagccgttgaattgatgaaggat
acgctggctaagaatgccatcgataaatctgagtacccccgcacggccgagattgaaaat
cggtgtgtgaacattattgccaatctgtggcacgcgcctgatgacgaacactttacgggt
acctctacgattggctcctctgaagcttgtatgttaggcggtttagcaatgaaatttgcc
tggcgtaaacgcgctcaagcggcaggcttagatttgaatgcccatcgacctaaccttgtt
atttcggctggctatcaagcttgctgggaaaagttttgtgtctactgggacgttgacatg
cacatggtcccaatggatgagcaacacatggcccttgacgttgaccacgtcttaaactac
gtggacgaatacacaattggtatcgtcggtatcatgggcatcacttataccggtcaatat
gacgacctagccgcactcgataaggtcgttactcactacaatcgtcagcattccaaatta
ccagtctacattcacgttgacgcagcgtcaggtggcttctataccccatttattgagccg
caactcatctgggacttccggttggctaacgtcgtttcgatcaacgcctccgggcacaag
tacggtttagtttatcccggggtcggctgggtcgtttggcgtgatcgtcagtttttaccg
ccagaattagtcttcaaagttagttatttaggtggagagttgccgacaatggtgatcaac
ttctcacatagcgcagcccagctcattggacaatactataatttcattcgcttcggtatg
gacggttaccgcgagattcaaacaaagactcacgatgttgcccgctacctggcagccgct
ctggataaagttggtgagtttaagatgatcaataacggacaccaactccctctgatttat
taccaactagccccgcgcgaagatcgcgaatggaccctttatgatttatcggatcgccta
ttaatgaacggttggcaagtaccaacgtatcctttacctgctaacctggaacaacaagtc
atccaacgaatcgtcgttcgggctgactttggcatgaatatggcccacgatttcatggat
gacctgaccaaggctgtccatgacttaaaccaagcccacattgtctatcatcatgacgcg
gcacctaagaaatacggattcacacactaa

DBGET integrated database retrieval system