KEGG   Lactobacillus plantarum subsp. plantarum ST-III: LPST_C1949Help
Entry
LPST_C1949        CDS       T01324                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lps  Lactobacillus plantarum subsp. plantarum ST-III
Pathway
lps00473  D-Alanine metabolism
lps00550  Peptidoglycan biosynthesis
lps01100  Metabolic pathways
lps01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lps00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LPST_C1949 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LPST_C1949 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LPST_C1949 (ddl)
Enzymes [BR:lps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LPST_C1949 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lps01011]
 Precursor biosynthesis
  Amino acid ligase
   LPST_C1949 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 ATP-grasp Chal_sti_synt_C
Motif
Other DBs
NCBI-ProteinID: ADN99165
LinkDB All DBs
Position
complement(2097114..2098226)
Genome map
AA seq 370 aa AA seqDB search
METQKKIHVGMLFGGNSSEHDVSKRSAHNIYDAMDKNKYEIDLFLITKNGIVLSDAATRR
VFDGEPEDQVVAEEMPKLDMSDPLAPIKNLTLAKDIDIFYPVVHGNLGEDGTLQGLFKLL
KKPYVGSGVLASAASFDKDITKQILTHHHIQNTKYVVVTPENRDQMTYAYLQAHVGDHLF
IKPANQGSSIGIHKAENEQEYLDGLADAFKYDYKILVEESIDNPREVECSILGNENPKAS
KLGAIDVPKTDTFYDYNNKFVDASGVTFELPVELPADLTKRIQQMSLDAFKALGLKGMAR
VDFLVSEDGEPYLGEINTLPGFTNISLYPKLWEVSGISYTALIDQLIQLGFDEFKRQSDI
HYDFVALDAE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggagacacaaaaaaagatccatgttggtatgttgtttggtggtaactcttcagaacat
gatgtttcgaagcgttcagcgcacaacatttatgatgccatggacaagaataagtacgag
attgacttgtttttaatcacgaagaacgggattgtcttgagtgatgctgcaactcggcgc
gtatttgatggtgaaccagaagatcaagtcgtcgccgaagaaatgccaaagttggacatg
agtgatccattagctcccatcaagaacctgacactggccaaagatattgatatcttctat
ccagtggttcatggtaacttaggggaagatggtactttacaagggctgttcaagttattg
aaaaagccgtatgttggtagtggtgtcttagcgtcggcagctagttttgataaggatatt
acgaagcagattttaacgcatcatcatattcaaaacaccaagtacgtggtggttacaccg
gaaaaccgggaccaaatgacgtacgcttatttacaagcccacgtgggtgatcatttattc
attaagccagccaatcaaggatcgtcgattgggattcataaagctgagaatgaacaagaa
tacttggatggtttggccgatgcgttcaaatatgactacaagattttagttgaagaatcg
attgacaatccgcgtgaagtggaatgctcgatcttaggcaatgaaaatcctaaggcatct
aagcttggtgccattgatgtgccgaagacggacacgttctacgactataataataagttc
gtggatgcaagtggtgtgacgttcgaattaccagtcgaattaccagctgatttgacgaaa
cggattcaacagatgtcgctagacgcgtttaaagcgcttggtctaaaaggaatggcacgc
gtcgatttcttagtgtctgaagatggtgaaccatacttgggtgaaatcaatacgttacct
ggttttactaacattagtttatatccaaagctatgggaagtttcgggcattagttatacg
gcgttgatcgatcaattgatccaacttggttttgatgaattcaaacgtcaatctgatatt
cactatgatttcgttgcgttagacgcggaataa

DBGET integrated database retrieval system