KEGG   Lactobacillus plantarum ZJ316: zj316_0058Help
Entry
zj316_0058        CDS       T02458                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    zj316_0058 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    zj316_0058 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    zj316_0058 (gadB)
   00430 Taurine and hypotaurine metabolism
    zj316_0058 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    zj316_0058 (gadB)
Enzymes [BR:lpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     zj316_0058 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
56260..57669
Genome map
AA seq 469 aa AA seqDB search
MAMLYGKHNHEAEEYLEPVFGAPSEQHDLPKYRLPKHSLSPREADRLVRDELLDEGNSRL
NLATFCQTYMEPEAVELMKDTLAKNAIDKSEYPRTAEIENRCVNIIANLWHAPDDEHFTG
TSTIGSSEACMLGGLAMKFAWRKRAQAAGLDLNAHRPNLVISAGYQVCWEKFCVYWDVDI
HVVPMDEQHMALDVNHVLDYVDEYTIGIVGIMGITYTGQYDDLAALDKVVTHYNHQHPKL
PVYIHVDAASGGFYTPFIEPQLIWDFRLANVVSINASGHKYGLVYPGVGWVVWRDRQFLP
PELVFKVSYLGGELPTMAINFSHSAAQLIGQYYNFIRFGMDGYREIQTKTHDVARYLAAA
LDKVGEFKMINNGHQLPLICYQLAPREDREWTLYDLSDRLLMNGWQVPTYPLPANLEQQV
IQRIVVRADFGMNMAHDFMDDLTKAVHDLNQAHIVYHHDAAPKKYGFTH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttatacggtaaacacaatcatgaagctgaagaatacttggaaccagtcttt
ggtgcgccttctgaacaacatgatcttcctaagtatcggttaccaaagcattcattatcc
cctcgagaagccgatcgcttagttcgtgatgaattattagatgaaggcaattcacgactg
aacctggcaactttttgtcagacctatatggaacccgaagccgttgaattgatgaaggat
acgctggctaagaatgccatcgacaaatctgagtacccccgcacggccgagattgaaaat
cggtgtgtgaacattattgccaatctgtggcacgcacctgatgacgaacactttacgggt
acctctacgattggctcctctgaagcttgtatgttaggcggtttagcaatgaaattcgcc
tggcgtaaacgcgctcaagcggcaggtttagatctgaatgcccatcgacctaacctcgtt
atttcggctggctatcaagtttgctgggaaaagttttgtgtctactgggacgttgacata
cacgtggtcccaatggatgagcaacacatggcccttgacgttaaccacgtcttagactac
gtggacgaatacacaattggtatcgtcggtatcatgggcatcacttataccggtcaatat
gacgacctagccgcactcgataaggtcgttactcactacaatcatcagcatcccaaatta
ccagtctacattcacgttgacgcagcgtcaggtggcttctataccccatttattgagccg
caactcatctgggacttccggttggctaacgtcgtttcgatcaacgcctccgggcacaag
tacggtttagtttatcccggggtcggctgggtcgtttggcgtgatcgtcagtttttaccg
ccagaattagtcttcaaagttagttatttaggtggggagttgccgacaatggcgatcaac
ttctcacatagcgcagcccagctcattggacaatactataatttcattcgcttcggtatg
gacggttaccgcgagattcaaacaaagactcacgatgttgcccgctacctggcagccgct
ctggataaagttggtgagtttaagatgatcaataacggacaccaactccctctgatttgt
taccaactagccccgcgcgaagatcgcgaatggaccctttatgatttatcggatcgccta
ttaatgaacggttggcaagtaccaacgtatcctttacctgctaacctggaacaacaagtc
atccaacgaatcgtcgttcgggctgactttggcatgaatatggcccacgatttcatggat
gacctgaccaaggctgtccatgacttaaaccaagcccacattgtctatcatcatgacgcg
gcacctaagaaatacggattcacacactaa

DBGET integrated database retrieval system