KEGG   Lactobacillus plantarum 16: Lp16_2680Help
Entry
Lp16_2680         CDS       T02698                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lpz  Lactobacillus plantarum 16
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Lp16_2680
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lp16_2680
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Lp16_2680
   00430 Taurine and hypotaurine metabolism
    Lp16_2680
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Lp16_2680
Enzymes [BR:lpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Lp16_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2860913..2862322
Genome map
AA seq 469 aa AA seqDB search
MAMLYGKHNHEAEEYLEPVFGAPSEQHDLPKYRLPKHSLSPREADRLVRDELLDEGNSRL
NLATFCQTYMEPEAVELMKDTLAKNAIDKSEYPRTAEIENRCVNIIANLWHAPDDEHFTG
TSTIGSSEACMLGGLAMKFAWRKRAQAAGLDLNAHRPNLVISAGYQACWEKFCVYWDVDM
HMVPMDEQHMALDVDHVLNYVDEYTIGIVGIMGITYTGQYDDLAALDKVVTHYNRQHSKL
PVYIHVDAASGGFYTPFIEPQLIWDFRLANVVSINASGHKYGLVYPGVGWVVWRDRQFLP
PELVFKVSYLGGELPTMAINFSHSAAQLIGQYYNFIRFGMDGYREIQTKTHDVARYLAAA
LDKVGEFKMINNGHQLPLICYQLAPREDREWTLYDLSDRLLMNGWQVPTYPLPANLEQQV
IQRIVVRADFGMNMAHDFMDDLTKAVHDLNQAHIVYHHDAAPKKYGFTH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttatacggtaaacacaatcatgaagctgaagaatacttggaaccagtcttt
ggtgcgccttctgaacaacatgatcttcctaagtatcggttaccaaagcattcattatcc
cctcgagaagccgatcgcttagttcgtgatgaactattagatgaaggcaattcacgactg
aacctggcaactttttgtcagacctatatggaacccgaagccgttgaattgatgaaggat
acgctggctaagaatgccatcgataaatctgagtacccccgcacggccgagattgaaaat
cggtgtgtgaacattattgccaatctgtggcacgcgcctgatgacgaacactttacgggt
acctctacgattggctcctctgaagcttgtatgttaggcggtttagcaatgaaatttgcc
tggcgtaaacgcgctcaagcggcaggcttagatttgaatgcccatcgacctaaccttgtt
atttcggctggctatcaagcttgctgggaaaagttttgtgtctactgggacgttgacatg
cacatggtcccaatggatgagcaacacatggcccttgacgttgaccacgtcttaaactac
gtggacgaatacacaattggtatcgtcggtatcatgggcatcacttataccggtcaatat
gacgacctagccgcactcgataaggtcgttactcactacaatcgtcagcattccaaatta
ccagtctacattcacgttgacgcagcgtcaggtggcttctataccccatttattgagccg
caactcatctgggacttccggttggctaacgtcgtttcgatcaacgcctccgggcacaag
tacggtttagtttatcccggggtcggctgggtcgtttggcgtgatcgtcagtttttaccg
ccagaattagtcttcaaagttagttatttaggtggagagttgccgacaatggcgatcaac
ttctcacatagcgcagcccagctcattggacaatactataatttcattcgcttcggtatg
gacggttaccgcgagattcaaacaaagactcacgatgttgcccgctacctggcagccgct
ctggataaagttggtgagtttaagatgatcaataacggacaccaactccctctgatttgt
taccaactagccccgcgcgaagatcgcgaatggaccctttatgatttatcggatcgccta
ttaatgaacggttggcaagtaccaacgtatcctttacctgctaacctggaacaacaagtc
atccaacgaatcgtcgttcgggctgactttggcatgaatatggcccacgatttcatggat
gacctgaccaaggctgtccatgacttaaaccaagcccacattgtctatcatcatgacgcg
gcacctaagaaatacggattcacacactaa

DBGET integrated database retrieval system