KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1161Help
Entry
LRHK_1161         CDS       T01961                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LRHK_1161
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LRHK_1161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1104970..1105563
Genome map
AA seq 197 aa AA seqDB search
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKRVILMTSAVDDRAGVGMIASRIGLERTAI
PIAHETNLYDVIKTTDPKAACVLIDEAQFLQKHHIFEAARVVDELHIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCAKKAIMNLRIHDGKPVYEGEQVLIGGNESYYPVC
RHHYFHPPLDKIDQDEE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcttttctttcgttatggcgcaatgaactcaggaaaaagtattgaaattctg
aaagttgcccacaattatgaagaacaaaataagcgcgtgattttaatgaccagcgccgtg
gatgatcgcgccggtgttggcatgatcgccagtcgcattggtcttgagcggactgcgatt
ccgattgcgcatgaaacgaatctgtatgatgtcattaaaacgactgatccgaaagcagca
tgtgttttaattgatgaggcgcagtttttgcagaagcatcatatttttgaagctgcgcgg
gtggttgacgagttgcatattccagtcatggcgtttggcttgaagaacgatttccgcaat
gagctgtttgaaggttcaaaatatttgttgctgtatgcggataagattgaagaaatgaag
acgatttgctggttttgtgcgaaaaaggcgattatgaatttacggattcacgatggcaag
ccggtgtatgaaggcgagcaggttttgattggcggcaatgaatcgtattatccggtttgc
cggcatcattattttcacccgccgttggataagattgatcaggatgaggaatag

DBGET integrated database retrieval system