KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_0153Help
Entry
LOCK908_0153      CDS       T02731                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lrc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LOCK908_0153
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LOCK908_0153
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LOCK908_0153
Enzymes [BR:lrc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LOCK908_0153
Peptidoglycan biosynthesis and degradation proteins [BR:lrc01011]
 Precursor biosynthesis
  Amino acid ligase
   LOCK908_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(167639..168721)
Genome map
AA seq 360 aa AA seqDB search
MKIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDLFLGYDLEGKTVDQVFDDANT
SKDLKISDAILTDADINKLRTDGSTQLFGPNVLAICKAADIVFLALHGGDGENGKVQATL
DLNNVKYTGSGPLASGITMNKVFSKEVMLYHGIQTAAFKEFKRNQNGKHTVPFDFPVVVK
PTSGGSSVGTHIAHNQEELENGIADVFRFDNSAIVEEFTPGREFSLGVVNGRAFSAIEIK
VHSGWYDFKHKFQAGYTDFITPPKNLDESVHQAMKDVSLQTMDVLGLQNYGRIDFFANDK
GVWVIEANNLPGMTPLSLLPQEAEADGVEYGDLVMDIINGKLKLYAEGMTEAGIMTTANH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgttttagcaggcggccggagcacggaacgcaatgtgtcgatttccagc
ggctaccggatcacgaacgccttgcgacaaaaagggcaacaggccaccttcattgacctg
tttcttggctacgaccttgagggaaaaacggttgaccaagtgtttgacgatgccaacacc
agtaaggatctgaaaatttcagatgccattctgactgacgccgacatcaacaagttacgg
acagacggcagcacgcaactgtttggtcctaacgttttggcgatctgcaaggctgcagat
attgtgttcttggcactgcatggtggtgatggcgaaaatggtaaggttcaggcaacgttg
gatctgaacaacgtcaaatataccggttccggtccgctggcttccggcattaccatgaac
aaggtcttcagcaaagaagttatgttataccacggcatccagactgcggcgttcaaagaa
ttcaaacgcaatcaaaatggtaaacatacggtaccgtttgactttccggttgtcgttaag
cctacatcaggcggctctagtgttggcacgcacattgcgcacaatcaagaggaactggaa
aatggcattgcagatgttttccggttcgataacagcgcgattgtcgaagaattcacccct
ggccgcgaattttctttaggcgttgtcaatggccgggcgttttctgccattgagattaaa
gtgcattccggttggtacgacttcaagcacaaattccaagcgggctacaccgacttcatc
acgccgcctaagaatctggatgaatcagttcatcaagcaatgaaggatgtctcgttacaa
accatggacgttttgggattgcaaaactatgggcggattgacttctttgccaacgataag
ggcgtctgggtgatcgaagccaacaacctgcctggcatgacaccactttcgctcttacca
caggaagccgaagcagatggcgtagaatatggcgatctcgttatggacattatcaacggt
aaactgaaactttacgcagaaggcatgacggaagccggcattatgaccacagccaatcac
tag

DBGET integrated database retrieval system