Labeo rohita (rohu): 127169623 Help Entry 127169623         CDS       T09007                                  Symbol b2ml Name (RefSeq) beta-2-microglobulin, like   KO K08055   beta-2-microglobulin Organism lroh  Labeo rohita (rohu) Pathway lroh05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:lroh00001]  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     127169623 (b2ml)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lroh04147]     127169623 (b2ml) Exosome [BR:lroh04147]  Exosomal proteins   Exosomal proteins of breast milk    127169623 (b2ml) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  C1-set Ig_3 Ig_2 Cna_B I-set Motif Other DBs NCBI-GeneID:  127169623 NCBI-ProteinID:  XP_050973087 LinkDB All DBs Position 8:complement(5307021..5311178) Genome browser AA seq 116 aa AA seqDB search MLKVVVAALVLLSASCLAKNVTDPKVQVYSRNPGEYGKPNVLICYVSGFHPPDITIELLK NGQEIPGSHQTDLAFEQGWQFHLTKFVDFNPQVGEVYTCRVRHMTNTKSYTWEPDM NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgaaagttgttgtagccgcactggtgcttctaagcgccagctgtcttgccaaaaat gtaacggaccccaaagtgcaggtgtacagccgtaaccctggagagtatgggaaaccaaac gtgctgatctgctatgtcagtggcttccaccccccagacatcaccattgagctcctgaag aacgggcaggagatcccaggcagccaccagaccgatctggcgttcgagcagggctggcag ttccacctgacaaagtttgtcgatttcaacccccaggttggagaggtgtacacctgcaga gtccgtcatatgaccaacacaaagtcctacacatgggaacctgacatgtga

DBGET integrated database retrieval system