Lynx rufus (bobcat): 124504954 Help Entry 124504954         CDS       T08475                                  Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism lruf  Lynx rufus (bobcat) Pathway lruf01523   Antifolate resistance lruf04010   MAPK signaling pathway lruf04014   Ras signaling pathway lruf04024   cAMP signaling pathway lruf04062   Chemokine signaling pathway lruf04064   NF-kappa B signaling pathway lruf04066   HIF-1 signaling pathway lruf04071   Sphingolipid signaling pathway lruf04137   Mitophagy - animal lruf04151   PI3K-Akt signaling pathway lruf04210   Apoptosis lruf04211   Longevity regulating pathway lruf04218   Cellular senescence lruf04380   Osteoclast differentiation lruf04613   Neutrophil extracellular trap formation lruf04620   Toll-like receptor signaling pathway lruf04621   NOD-like receptor signaling pathway lruf04622   RIG-I-like receptor signaling pathway lruf04623   Cytosolic DNA-sensing pathway lruf04625   C-type lectin receptor signaling pathway lruf04657   IL-17 signaling pathway lruf04658   Th1 and Th2 cell differentiation lruf04659   Th17 cell differentiation lruf04660   T cell receptor signaling pathway lruf04662   B cell receptor signaling pathway lruf04668   TNF signaling pathway lruf04722   Neurotrophin signaling pathway lruf04917   Prolactin signaling pathway lruf04920   Adipocytokine signaling pathway lruf04926   Relaxin signaling pathway lruf04931   Insulin resistance lruf04932   Non-alcoholic fatty liver disease lruf04933   AGE-RAGE signaling pathway in diabetic complications lruf04936   Alcoholic liver disease lruf05010   Alzheimer disease lruf05022   Pathways of neurodegeneration - multiple diseases lruf05030   Cocaine addiction lruf05132   Salmonella infection lruf05133   Pertussis lruf05134   Legionellosis lruf05135   Yersinia infection lruf05140   Leishmaniasis lruf05142   Chagas disease lruf05145   Toxoplasmosis lruf05146   Amoebiasis lruf05152   Tuberculosis lruf05160   Hepatitis C lruf05161   Hepatitis B lruf05162   Measles lruf05163   Human cytomegalovirus infection lruf05164   Influenza A lruf05165   Human papillomavirus infection lruf05166   Human T-cell leukemia virus 1 infection lruf05167   Kaposi sarcoma-associated herpesvirus infection lruf05168   Herpes simplex virus 1 infection lruf05169   Epstein-Barr virus infection lruf05170   Human immunodeficiency virus 1 infection lruf05171   Coronavirus disease - COVID-19 lruf05200   Pathways in cancer lruf05202   Transcriptional misregulation in cancer lruf05203   Viral carcinogenesis lruf05207   Chemical carcinogenesis - receptor activation lruf05208   Chemical carcinogenesis - reactive oxygen species lruf05212   Pancreatic cancer lruf05215   Prostate cancer lruf05220   Chronic myeloid leukemia lruf05221   Acute myeloid leukemia lruf05222   Small cell lung cancer lruf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lruf05321   Inflammatory bowel disease lruf05415   Diabetic cardiomyopathy lruf05417   Lipid and atherosclerosis lruf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124504954    04014 Ras signaling pathway     124504954    04064 NF-kappa B signaling pathway     124504954    04668 TNF signaling pathway     124504954    04066 HIF-1 signaling pathway     124504954    04071 Sphingolipid signaling pathway     124504954    04024 cAMP signaling pathway     124504954    04151 PI3K-Akt signaling pathway     124504954  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     124504954   09143 Cell growth and death    04210 Apoptosis     124504954    04218 Cellular senescence     124504954  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     124504954    04620 Toll-like receptor signaling pathway     124504954    04621 NOD-like receptor signaling pathway     124504954    04622 RIG-I-like receptor signaling pathway     124504954    04623 Cytosolic DNA-sensing pathway     124504954    04625 C-type lectin receptor signaling pathway     124504954    04660 T cell receptor signaling pathway     124504954    04658 Th1 and Th2 cell differentiation     124504954    04659 Th17 cell differentiation     124504954    04657 IL-17 signaling pathway     124504954    04662 B cell receptor signaling pathway     124504954    04062 Chemokine signaling pathway     124504954   09152 Endocrine system    04920 Adipocytokine signaling pathway     124504954    04917 Prolactin signaling pathway     124504954    04926 Relaxin signaling pathway     124504954   09156 Nervous system    04722 Neurotrophin signaling pathway     124504954   09158 Development and regeneration    04380 Osteoclast differentiation     124504954   09149 Aging    04211 Longevity regulating pathway     124504954  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     124504954    05202 Transcriptional misregulation in cancer     124504954    05207 Chemical carcinogenesis - receptor activation     124504954    05208 Chemical carcinogenesis - reactive oxygen species     124504954    05203 Viral carcinogenesis     124504954    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     124504954   09162 Cancer: specific types    05212 Pancreatic cancer     124504954    05221 Acute myeloid leukemia     124504954    05220 Chronic myeloid leukemia     124504954    05215 Prostate cancer     124504954    05222 Small cell lung cancer     124504954   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124504954    05170 Human immunodeficiency virus 1 infection     124504954    05161 Hepatitis B     124504954    05160 Hepatitis C     124504954    05171 Coronavirus disease - COVID-19     124504954    05164 Influenza A     124504954    05162 Measles     124504954    05168 Herpes simplex virus 1 infection     124504954    05163 Human cytomegalovirus infection     124504954    05167 Kaposi sarcoma-associated herpesvirus infection     124504954    05169 Epstein-Barr virus infection     124504954    05165 Human papillomavirus infection     124504954   09171 Infectious disease: bacterial    05132 Salmonella infection     124504954    05135 Yersinia infection     124504954    05133 Pertussis     124504954    05134 Legionellosis     124504954    05152 Tuberculosis     124504954   09174 Infectious disease: parasitic    05146 Amoebiasis     124504954    05145 Toxoplasmosis     124504954    05140 Leishmaniasis     124504954    05142 Chagas disease     124504954   09163 Immune disease    05321 Inflammatory bowel disease     124504954   09164 Neurodegenerative disease    05010 Alzheimer disease     124504954    05022 Pathways of neurodegeneration - multiple diseases     124504954   09165 Substance dependence    05030 Cocaine addiction     124504954   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124504954    05418 Fluid shear stress and atherosclerosis     124504954    05415 Diabetic cardiomyopathy     124504954   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     124504954    04932 Non-alcoholic fatty liver disease     124504954    04931 Insulin resistance     124504954    04933 AGE-RAGE signaling pathway in diabetic complications     124504954   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     124504954  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:lruf03000]     124504954 Transcription factors [BR:lruf03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     124504954 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  124504954 NCBI-ProteinID:  XP_046926620 LinkDB All DBs Position Unknown AA seq 555 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPAPILAPGL AQAVVPPAPKTTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ LLNQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS IADMDFSALLSQISS NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcgggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac ccccctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg catcccatctttgacaaccgtgcccccaacaccgcggagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcagctgcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtcttcccttccgggcagatcccaagccagacccctgccttg gcaccagcccctgccccaatcctggccccggcccctgcctctgtcccggcccctgcccct gtccccgcccctgccccggccccagccccggcccctgccccaatcttagccccaggcctt gctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg gaggccctgctgcacctgcagtttgacgctgatgaagacctgggggccctgcttggcaac agcgccgacccagcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag ctgctgaaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaatac cctgaggcaataactcgcctggtgacgggatcccagaggccccctgacccagctcccgct cccctgggggcctctgggcttcccaacggcctcctctcaggggatgaagacttctcttcc attgccgacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system