KEGG   Luteibacter rhizovicinus: BJI69_04135Help
Entry
BJI69_04135       CDS       T04563                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lrz  Luteibacter rhizovicinus
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lrz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJI69_04135
  Energy metabolism
   00680 Methane metabolism
    BJI69_04135
Enzymes [BR:lrz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BJI69_04135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(885695..888400)
Genome map
AA seq 901 aa AA seqDB search
MEVARDPEFLPHDGPLREDVRRLGTLVGQMLAEQGGQAFYERVEHVRTTAIHRRRSGAAV
DALAAPLTGLEAADAESLARAFATYFQAVNTAERVHRIRRRRDYQREGGAAQPESLAAVL
GRLKKDGVGRDELTALLGRLDVEPVFTAHPTEAVRRSLLEKEQEIVRALVDEFDPTRTPQ
ELRDDDARILMALSAGWQTAEASPVRPSVQDEFDHVGFYIARPIYRVLPALYEALEQALA
ETYGEGITIPRLLRFATWVGGDMDGNPNVNAETIAATLGAQRSLVLERYLEDVAELGRLL
SQTDDRVALDDRLVRRLERYREELPEAAAAIRPRHADMPYRSFLKFVAARLEATLQEKPA
AYAAADEFIDDIALVDTSLVTHGGKHAGAYAVGRLLWRARTFGFHLARLDVRQDARVHDE
ALSALLDDAEFANHDTAARVKALRPYAAGERSFVAGDDHEAATMLREVFATLADSRTRYG
QEATGLYIISMAESAADVLAVLALARRGGLVEDGRVPLDVAPLFETIDDLAGGAETLQAL
LDDPVYREHLKARGDRQWVMLGYSDSGKDGGTLASKWSLQRAQVDLLEVASKAGIRVAFF
HGRGGSASRGGSRITPALMASPRGSVGGVLRVTEQGEVIHRKYGIRALAVRNLEQTLGAV
MRASLRPREVDVREPAWKDTMARLSAESRTAYRAFVDTEGFVDYFRGATPIDVIERMTLG
SRPARRRSMKGVEDLRAIPWVFSWTQCRAVLTGWYGLGSALDVVAKDCGEERLVEMARDW
PFVSTMLDDVEMVLAKADIDIAEAFSKLAGPLHERFFPMIRAEFERTVAWVLKLKGADEL
LAGDPRLATSIRLRNPYVDPMSLLQVDLLKRWRATDGKDDALLSALVACVNGVSQGLQNT
G
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcgcacgcgatcccgaattcctgccccacgacggccccttgcgcgaagacgtg
cgccgtcttggcaccctggtcggccagatgctcgccgagcagggcggccaggccttctac
gagcgcgtcgagcacgtgcggacgaccgcgatccaccgccggcgcagtggcgcggccgtg
gacgccctggccgcgccgctcaccggcctggaggctgctgatgccgaatccctggcgcgc
gccttcgccacgtatttccaggcggtgaataccgccgaacgcgtccaccgcattcgtcgt
cgccgcgattaccagcgggaaggcggggcagcccagcccgaatcgctcgccgcggtgctc
ggtcgcctcaagaaggacggggtcggtcgcgacgaactcacggcgctgctcggccgtctc
gatgtcgagcccgtgttcaccgcgcatccgaccgaggccgtgcgtcgttcgctgctggag
aaagagcaggagatcgtgcgtgccctggtcgacgagttcgacccgacgcgtacgccgcag
gagctgcgcgacgacgacgcgcgcatcctcatggcgctgtccgccggctggcagaccgcg
gaggcctcgccggtgcggccgagcgtgcaggacgagttcgatcacgtcggcttctacatc
gcgcgaccgatctaccgcgtgctgccggcactgtacgaggccctcgagcaggcgcttgct
gaaacctacggcgaaggcatcacgattccgcggctgttgcggttcgcgacctgggtcggc
ggtgacatggacggcaatcccaacgtcaacgcggagaccattgcggcgacgctgggcgcg
caacgctcgctggttctggaacgttatctcgaggacgtcgcggagctgggccgattgctc
agccagaccgacgatcgggtggcgctcgatgaccggctcgttcgccggctggagcgctat
cgcgaggaacttcccgaagccgcggcggccattcgtccgcgtcacgccgatatgccgtat
cgcagcttcctgaaattcgtcgccgcgcggctggaggcgacgttgcaggagaagccggcg
gcttacgccgcggccgacgaattcattgacgacatcgcgctggtcgataccagcctcgtc
acccatggcggcaagcatgccggcgcctatgccgtcggtcgcctgctttggcgtgcacgc
acgttcggcttccatctggcccggctggacgttcgccaggatgcgcgcgtgcatgacgag
gccctgtccgccttgctcgatgacgcggaattcgcgaaccacgacacggccgcgcgggtg
aaggcactacgcccttacgccgccggagaacggagtttcgtcgccggtgacgatcacgag
gccgcgacgatgctgcgcgaggtgttcgccacgctggccgattcgcgcacgcgctacggc
caggaagccacgggcctctacatcatcagcatggccgaaagcgcggccgacgtgctcgcc
gtgctggcgctggcccgtcgcggtggcctggtcgaagacggccgcgtgccactcgatgtc
gccccgctgttcgagacgatcgacgatctcgccggcggcgccgagaccttgcaggcactg
ctggacgatcccgtctaccgcgagcatctgaaggcccggggcgatcgccagtgggtgatg
ctcggctattccgacagcggcaaggacggcggcacgctggcgtcgaagtggagcctgcag
cgtgcccaggtcgacctgctcgaggtggcatcgaaggccggcatccgcgtcgcctttttc
cacggtcgcggtggttcagccagccgcggcggctcgcgcatcaccccggccctcatggcc
tcgccccgtggttccgtgggcggcgtgctacgcgtgaccgagcagggtgaagtgattcat
cgcaagtacggcattcgcgctctggccgtgcgtaacctcgagcagacgcttggtgcggtg
atgcgtgcctcgctgcgcccgcgcgaggtcgacgtgcgcgagccggcgtggaaggacacg
atggcccggctttccgcggagagtcgcacggcgtaccgcgcgttcgtcgacaccgaaggc
ttcgtcgattatttccgtggcgccacgcccatcgatgtcatcgagcgcatgacgctcggt
tcgcgtccggcacgtcgccgcagcatgaaaggcgtggaagacctccgcgcgattccctgg
gttttttcctggacgcagtgccgtgccgtactcaccggctggtacgggctgggcagcgcg
ctcgacgtcgtcgcgaaggattgcggcgaggagcgcctcgtggagatggcgcgtgactgg
cccttcgtctcgaccatgctggacgatgtggaaatggtcctggcgaaggccgatatcgac
atcgccgaagcgttctcgaagcttgcgggcccgctccacgagcgcttcttcccgatgatc
cgcgccgagttcgaacggacggtggcctgggtgctcaagctgaagggcgccgatgaactg
ctggccggcgaccctcgcctggcgacgtcgatccgtctgcgcaatccgtacgtggatccg
atgagcctgctccaggtcgacctgctcaagcgctggcgggcgacggacggcaaggacgac
gccttgctcagcgccctggtggcctgcgtcaacggcgtatcgcagggcctgcagaacacg
ggctga

DBGET integrated database retrieval system