KEGG   Lactobacillus sakei: LCA_1138Help
Entry
LCA_1138          CDS       T00299                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase (deoxuuridine kinase)
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lsa  Lactobacillus sakei
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LCA_1138 (tdk)
Enzymes [BR:lsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LCA_1138 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1125569..1126162)
Genome map
AA seq 197 aa AA seqDB search
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKSVIILTSGIDNRDGVGIVSSRIGLKREAT
PIFSDTNIYELVEATNPDAACVLIDESQFLERHHVIEAAKVVDDLNIPVMAFGLKNDFKN
ELFEGSKYLLLFANKIEEMKTICWFCRKKAIMNLRMNNGLPVYTGEQIQIGGNEAYYPVC
RKHYFNPPIQEEIEKEG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaattattttttcgatatggtgcaatgaacagtggtaaatcaattgaaattcta
aaagttgctcataattatgaagaacagaataaatcagtgattatcttaaccagtgggatt
gataatcgtgacggcgtgggaatcgtttcaagtcgaattggtttgaaacgcgaagcaaca
ccaatcttttcggacacgaatatttacgaattggttgaagcaactaatccagatgccgct
tgtgttttaattgatgaatcacaatttttagaacggcaccatgttatcgaagctgccaaa
gtcgttgatgatttgaatatcccggtgatggcgtttggtcttaaaaatgattttaagaat
gaattatttgaaggctcgaaatacctcttattgtttgccaataagatagaagaaatgaag
accatttgttggttctgccgtaaaaaggcgattatgaacttgcgaatgaataacggcttg
cctgtttatacaggtgaacagattcaaatcggtggcaatgaagcttactatccagtatgc
cggaagcactattttaacccaccaatacaagaagagattgaaaaggaaggctaa

DBGET integrated database retrieval system