KEGG   Lactobacillus salivarius CECT 5713: HN6_00526Help
Entry
HN6_00526         CDS       T01962                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HN6_00526 (tdk)
Enzymes [BR:lsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HN6_00526 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
633676..634281
Genome map
AA seq 201 aa AA seqDB search
MAQLFFRYGAMNSGKTIEILKVAHNYEEQGKNVIIMTSGLDNRDGYGYVSSRIGLKRKAI
PVVSETNIKDLVEQSSLEPACILVDEAQFLEKHHVLELTQIVDELNIPVMTFGLKNDFMN
ELFEGSKYLLLYADKIEEMKTICWFCNKKAIMNLRMHDSKPVYSGEQIMIGGNESYYPVC
RKHYFNPPINNLEKDEGEING
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaacttttttttcgctatggagcgatgaatagtggtaagacaatcgaaatcctt
aaagttgcacataattatgaagaacaagggaaaaatgttattatcatgacaagtggtttg
gataatcgcgatggttatggttatgtttctagtcgtataggtttgaaaagaaaagctatt
ccagttgttagtgaaactaatattaaagatctagtagaacaatcttctttagagcctgcc
tgtattttagttgatgaggcacaatttttagaaaaacatcatgtattggaattaactcag
attgtagatgaactgaatattcctgtaatgacttttgggttaaaaaatgattttatgaat
gagttgtttgaaggatctaaatatcttttattatatgctgacaaaatagaagaaatgaag
acaatttgttggttttgtaataaaaaggctattatgaatttaagaatgcatgattctaaa
ccggtatatagtggtgaacagataatgattggtggtaatgaatcttattatccagtatgt
agaaaacattattttaatccacctattaataatttagaaaaagatgaaggagaaataaat
ggataa

DBGET integrated database retrieval system