KEGG   Lysinibacillus sphaericus: Bsph_0818Help
Entry
Bsph_0818         CDS       T00656                                 

Definition
(GenBank) Superoxide dismutase [Cu-Zn] 2 precursor
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lsp  Lysinibacillus sphaericus
Brite
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bsph_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
855627..856178
Genome map
AA seq 183 aa AA seqDB search
MKKTSLISLSLLVLVGGCGFFDKKEEKVQVNASSPLTATAKVIGANNESYGNAYFQEEDN
GVMMTLALTGLPPGTHGIHIHEVGKCEPPKFESAGSHFNPTKKEHGKLNPNGYHLGDLPN
LEVGDDGNVDLNFLAEGLTLQKDQPNSLLDSDGSSIVIHESADDYKTDPAGNSGARIACG
VIQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaagcttaattagcctttctttattagttttagtgggtggttgtggtttc
tttgataagaaagaagaaaaagtacaagtaaatgcgtcatcccccttaacagctactgca
aaagtaattggtgcaaataacgaaagctatgggaatgcgtattttcaggaagaagataat
ggtgttatgatgacactggcattaacaggactacccccaggtacacatggaattcatatt
catgaagtagggaagtgtgagccccctaaatttgaatcggctggttcgcactttaatccg
accaagaaagagcatggtaagttaaatcccaatggttatcatttaggggatttaccaaat
ctagaggttggtgacgatggcaatgtcgatttaaacttcttagcagaagggctaacacta
caaaaagatcagccaaattctttgttagacagtgatggtagttccatcgttattcatgag
tcagcagatgattataaaacagatccagcaggtaattcaggggcaagaattgcttgtggt
gtcattcaatag

DBGET integrated database retrieval system