KEGG   Lachancea thermotolerans: KLTH0E14080gHelp
Entry
KLTH0E14080g      CDS       T01117                                 

Definition
(RefSeq) KLTH0E14080p
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
lth  Lachancea thermotolerans
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    KLTH0E14080g
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KLTH0E14080g
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KLTH0E14080g
   00430 Taurine and hypotaurine metabolism
    KLTH0E14080g
Enzymes [BR:lth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KLTH0E14080g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
E:1244955..1246658
Genome map
AA seq 567 aa AA seqDB search
MLHKHNPKHVHERSEHFGRSGDSLSNSYKLLSDDLQKIALEGDSELQTKHRSLGSSYTIP
QTGLPSEAAYELVHNELTLDGNPHLNLASFVSTTSTQTARRLIMENIEKNLADNDEYPQM
IELTQRCISMLAQLWKCGKDTKPLGCATTGSSEAIMLGGLAMKRQWEKKMKEAGKSTEKP
NIIMSSAAQVALEKFARYFDVECRLVPVSHESDHHLDAAKLWDYVDENTIGCYVILGTTY
TGHLENVEEVADVLSQIEKQNPGWGNTTIPIHVDGASGGFVVPFAFSEKQMAAFKLARWG
FNHPRVVSINTSGHKFGLTTPGLGWILWKDDEYLLPELRFKLTYLGGVEETFNLNFSRPG
FQVIHQYYNFLTLGEKGYKSLFDKALFTARTFSHALLESDEFKGHFEVVSSIHERIDGGE
SRLHDYMTEPESFKPGVPLVAFKLSKQFHEKYPEIPQALVSSLLRSHGWIVPNYPLPAST
DGSDKWEVLRVVFRSEMSLDLAQLLLSHILRALRKLVKCYEGVAETADVDQRRDAIYRML
LTLAEPEGAEPSEEDAKKRRKNYRGTC
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacaagcataacccaaagcacgtccacgaacgctcggaacacttcggccgtagt
ggcgattcgctttcgaacagctacaagctgttgtcggacgatcttcaaaagatcgcttta
gaaggcgacagtgagttgcagactaagcacaggtcgcttggcagctcttacacgatccct
caaacggggctgccaagtgaggcagcctacgaactagttcacaacgagctgacgcttgac
ggtaacccacatctcaacctggccagtttcgtgagcacaacgtcgacacagaccgcgcgc
agactcattatggagaacatcgagaagaacctggcggacaacgacgagtatccacagatg
atcgagctaacgcagcggtgcatttcaatgctggcgcagctgtggaagtgtggtaaagac
acgaaacctctcggttgcgcgactacagggtcgagtgaggctatcatgctcggcgggctg
gcgatgaagcgccagtgggagaaaaagatgaaggaggccggcaagtcgactgaaaagcct
aacatcatcatgtctagcgcagcgcaggtcgcgctggagaagttcgctcgctacttcgac
gtggaatgccgtttggtgcccgtttcgcacgagtcggaccaccacttggacgcggctaag
ctgtgggactacgtggacgaaaacaccatcgggtgctacgtgattctgggtacgacgtac
accggtcacctggagaacgtggaggaggtggcagacgtgctctcgcagatcgagaagcag
aacccagggtggggtaacacgacgatcccaatccacgtggacggggcctcgggtggcttc
gtcgtgccctttgcgttctctgagaagcagatggccgccttcaagctagcgcgctggggt
ttcaaccacccccgtgtggtgagcatcaacacttcgggccacaagttcgggctcaccacg
cccgggctgggctggatcctgtggaaggacgacgaatacctgctgcccgagctgcgcttc
aagctgacgtacctcggcggtgtcgaggagacgttcaacctcaacttctcgcgccccggg
ttccaagtcatccaccagtactacaacttcctgacgctgggcgaaaagggctacaagagc
ctgttcgacaaggcgctgttcacggcacgcaccttcagtcacgcactgttggaaagcgac
gagttcaagggccacttcgaggtcgtcagcagcatccacgagcgcattgacggcggtgag
tctcgcctgcacgactacatgaccgagcccgagagcttcaaaccgggcgtgcccctggtc
gcgttcaagctttcgaagcagttccacgagaaatacccggagatcccacaggcgctggtg
tcgtcgctgctgcgcagccacggctggattgtgcccaactatccactgcccgcgtcgacg
gacggctccgacaagtgggaagtgctgagagtcgtgttccgctccgagatgagcttggac
ctggcccagctactgctgagccacatcttgcgggccctgcggaagctggtgaagtgctac
gaaggcgtggctgagaccgcggacgtggaccagcgccgcgacgccatctaccgcatgctt
ttgacgctggcggagcctgagggcgcagaaccctccgaggaagatgccaagaagcgccgg
aagaactaccgcggcacgtgctag

DBGET integrated database retrieval system