KEGG   Lachancea thermotolerans: KLTH0H08316gHelp
Entry
KLTH0H08316g      CDS       T01117                                 

Definition
(RefSeq) KLTH0H08316p
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lth  Lachancea thermotolerans
Pathway
lth04011  MAPK signaling pathway - yeast
lth04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lth00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KLTH0H08316g
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    KLTH0H08316g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KLTH0H08316g
Protein kinases [BR:lth01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   KLTH0H08316g
Chromosome and associated proteins [BR:lth03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     KLTH0H08316g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KLTH0H08316g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 8294559
NCBI-ProteinID: XP_002556241
UniProt: C5E2W8
LinkDB All DBs
Position
H:730027..731094
Genome map
AA seq 355 aa AA seqDB search
MGKKIVFNISSEFQLQQMLGEGAYGVVCSARHLPTGQMVAIKKIEPFDRPLFCLRTLREI
KLLRCFQHENIISIFDIQRPASFETFSEVYIIQELMDTDLHRVITTQTLSDDHVQYFVYQ
ILRALKCLHGAEVIHRDLKPSNLLVNANCDLKLCDFGLARCAGGGTKPGDAGHMTEYVAT
RWYRAPEVMLTAAEYTFAMDVWSCGCILAELLMRRPLFPGKDYHHQLLLIFQVIGSPTAG
DLGCVRSKRARQYLNTLPRYAGDGNLRSLVPDASAEALDLLEQMLVFDPRRRITASQALK
HPYLQAYHDPQDEPATAKVDPALFHFDERKDKLGAGDLKRLLWDEIFGKRERTDS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaaaatagtattcaacatatcttctgagttccagctccagcagatgctcggg
gaaggcgcgtacggcgtagtgtgtagcgcgcggcatcttcccaccggccagatggtcgcg
atcaagaaaatcgagccctttgacagaccgctgttctgcctgcggacgctgcgtgagatc
aagcttctgcgctgcttccagcacgagaacatcatctcgatattcgacatccaaagaccc
gcgtctttcgagacctttagcgaggtctatatcatccaggagctgatggatacggaccta
catcgggtcatcaccacacaaacactttcggacgaccacgtccagtattttgtttaccaa
atcctgcgtgcgctcaagtgtctacacggagcagaggtcatccaccgagacctgaagccg
tcgaaccttttagtcaacgcgaactgcgatctgaagctgtgcgactttggcctcgcgcgg
tgcgcgggcggtggaacgaagccaggcgacgcgggccatatgaccgagtacgtcgccaca
cggtggtaccgagcgcccgaggttatgctgacggctgccgaatacacgttcgccatggac
gtgtggtcctgcgggtgcatcctagcggagctgctgatgcgcagaccactctttccgggc
aaagactaccaccaccagttgttgcttattttccaggtcataggatcaccgaccgcaggc
gatttggggtgtgtacgctcgaagcgcgcgcggcagtatctgaatacactgccccgctac
gcgggagacggcaacctgcgctcgctggtcccggacgcgagcgcggaggcgctagaccta
ttggagcagatgttggtgttcgacccgcgccgccgcatcaccgcatctcaggccctgaag
catccgtacctgcaggcctaccacgacccacaagacgagcccgcgaccgccaaagttgac
ccggcactgtttcacttcgacgagcgcaaagacaagctgggcgccggtgacctcaagcgc
ctgctgtgggacgagattttcgggaagcgcgagcgcacggactcttaa

DBGET integrated database retrieval system