KEGG   Luteimonas sp. 100111: CNR27_03675Help
Entry
CNR27_03675       CDS       T05077                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lum  Luteimonas sp. 100111
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lum00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNR27_03675
  Energy metabolism
   00680 Methane metabolism
    CNR27_03675
Enzymes [BR:lum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CNR27_03675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
815032..817752
Genome map
AA seq 906 aa AA seqDB search
MSAQDDLPPLRDIGFAQTDRLLRDDVRRLGAMVGNMLSEQVSPALLEQVEGVRRAAIARR
EMGAPVDALAESLAGVSLDDADALVRAFAAYFGAINLAERVHRIRRRRDYQRAGDGPQPG
GLEAALRSLRDAGVDLPQLEAVLARLSIEPVFTAHPTEAVRRVLLEKERTIVERLIADID
RERTPIERRADDARIVLALTSAWQTSESPARKPTVADEVEHVGYYLSNVLYRVLPVFYEA
LGEAIESVYGTRPALPQVLRFGTWVGGDMDGNPNVNADTMRAALGAQRSQALAQYRRDLR
ALGNVLTQTSDRVSVDEAVIARVDDYRRRLPDAESVLNPRHADMPYRRLLDLMQLRLRLT
DADHRAGYPDATAFLDDLALMEASLREHRGAHAGLFALERLLWRARTFGFHLAALDLRQD
SAVHDEVLGHIDGSDWSALDVETRVSRLHAMLDAPPGAGGAMSNESVASTLGVFDAVTDL
RRSHGAAATGLYIISMARNAADALAVLALARIAGCVEAGQVPLDVSPLFETVDDLQAAPT
VMRALFDDPRYRAHLAARGDRQVVMLGYSDSAKDGGLLASRWALQRTQVELTALAREAGL
RIVFFHGRGGSVSRGGGKTGRAIDAAPRGSVDGSLRVTEQGEVIHRKYGIRALALRNLEQ
STAAVLQATLRPRAPDSREDSWRAIAAELAEVSRAHYRALVHERSDFPDYFRTATPIDVI
ERLQIGSRPSRRREGGIGNLRAIPWVFAWSQNRSGLTGWYGLGTALQHGIVVHGQQAMTE
MTRDWPFFRAALDDVEMLLAKSDIAIFERYSQLAGDAHDAFFPGILDEFLRTRDAILLLK
SQEVLLADDYRLQLSIRLRNPYVDPISLLQVELLRRWRESGREDEALLRALVSTVNGIAA
GIQNTG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcccaagacgatctgccgccgctgcgcgatatcggattcgcccagaccgaccgc
ctgcttcgcgacgatgtgcgccggctcggcgcgatggtcgggaacatgctctcggaacag
gtctcgccagccctgctcgagcaggtggaaggtgtgcgccgggcggcgatcgcgcggcgc
gagatgggcgcgccggtggacgcgctcgcagagagcctggccggggtttcgctcgacgat
gcagacgcgctggtgcgggcattcgccgcctatttcggcgcgatcaacctggccgaacgt
gtccatcgcatccgccgccgccgcgactaccagcgcgccggcgatggcccgcagcctggc
gggctggaagcggcattgcgttcgctgcgggacgccggcgtcgatctgccacagctcgag
gccgtgctggcacgcctgagcatcgagccggtgttcaccgcccaccccaccgaggccgtg
cgccgcgtgctgctggagaaggagcggacgatcgtcgagcgcctgattgccgacatcgac
cgcgagcgcacgccgatcgagcgccgcgccgacgacgcgcgcatcgtgctggcgctgacc
tcggcctggcagacctcggaatcgcccgcacgcaagccgaccgtcgccgacgaggtcgag
catgtcggctactacctgtccaacgtgctctatcgcgtgctgccggtgttctacgaggcg
ctcggcgaggccatcgagtccgtgtacggcacgcgccccgctttgccgcaggtgttgcgc
ttcggcacctgggtcggcggcgacatggacggcaaccccaacgtcaacgccgacaccatg
cgcgcggcgctgggcgcgcagcgcagccaggcactggcgcagtaccgccgcgacctgcgc
gcgctgggcaacgtgctgacccagacctccgaccgggtgtcggtcgacgaagcggtcatc
gcgcgcgtcgacgactaccggcgccggctgccggatgcggagtccgtgctcaatccgcgc
catgccgacatgccctaccggcgcctgctcgacctgatgcagctgcgtttgcgcctgacc
gatgccgaccaccgcgccggctacccggacgccaccgcattcctcgacgacctggcactg
atggaggcgagcctgcgcgagcaccgcggcgcgcacgccggcctgttcgcgctcgagcgt
ctgctgtggcgcgcgcggaccttcggcttccatctcgctgcgctcgacctgcgccaggat
tcggcggtgcacgacgaggtgctcggccacatcgacggcagcgactggagcgcgctcgat
gtcgaaacgcgcgtgtcgcgactgcacgcgatgctcgacgcgccgccgggggccgggggc
gcgatgtcgaacgagagcgttgcctcgacgctcggcgtgttcgatgcggtcaccgatctg
cgccgcagccatggcgctgcggcgaccggcctgtacatcatctcgatggcgcgcaacgcg
gccgatgcgctggcggtgctggcgctcgcgcgcattgccggttgcgtcgaggccggccag
gtgccgctggacgtgtcgccactgttcgagaccgtcgacgatctgcaggccgcgcccacg
gtgatgcgcgcgctgttcgacgacccgcgctatcgcgcgcacctggccgcgcggggcgac
cggcaggtggtgatgctgggctattccgacagcgcgaaggacggcggcctgctggcctcg
cgctgggcgctgcagcgcacccaggtcgagctgaccgcgctcgcccgcgaggccggcctg
cgcatcgtgttcttccacggccgtggcggctcggtgagccgcggtggcggcaagaccggc
cgcgcgatcgatgcggcgccgcgtggttcggtggacggcagcctgcgggtgaccgaacag
ggcgaggtgatccaccgcaagtacggcatccgtgcgctcgcgctgcgcaacctcgaacag
tcgaccgcggcggtgctgcaggcgaccttgcgcccgcgcgcgcccgactcgcgcgaagac
agctggcgcgcgatcgccgccgagctggccgaggtgtcgcgcgcgcactaccgcgcgctg
gtgcacgagcgcagcgattttcccgactacttccgcaccgcgacgccgatcgacgtgatc
gaacggctgcagatcggctcgcgtccatcgcgcaggcgcgaaggcggcatcggcaacctg
cgggcgattccctgggtgttcgcctggtcgcagaatcgttccggactcaccggctggtac
gggctgggcaccgcgctccagcacggcatcgtcgtgcatggccagcaggcgatgaccgag
atgacccgcgactggccgttcttccgcgcagcgctcgacgatgtcgagatgcttctggcc
aagagcgacatcgcgatcttcgaacgctattcgcagctggccggcgacgcgcacgatgcc
ttcttcccgggcatcctcgacgaattcctgcgcacgcgcgatgccatcctgctgctcaag
tcacaggaggtgctgctggccgacgactatcgactgcagctgtcgatccgtctgcgcaat
ccctatgtcgatccgatcagcctgctgcaggtggaactgctgcggcgctggcgcgagtcc
ggtcgcgaggacgaggcgttgctgcgggccctggtctcgaccgtcaacgggatcgcggcc
gggatccagaacaccggttga

DBGET integrated database retrieval system