KEGG   Lipotes vexillifer (Yangtze River dolphin): 103084172Help
Entry
103084172         CDS       T03090                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
Enzymes [BR:lve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103084172 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103084172
NCBI-ProteinID: XP_007465489
LinkDB All DBs
Position
Un
AA seq 779 aa AA seqDB search
MGLPPKASSSIQLVQLSPRIRRDCPRLAVMNGGLVCDRSSSTRKWTASAGVLHMKCGELG
CPCCPMLRAVRCDKGSVISSLLFCLTALELQSVDWQISFNEQAHHTDKFSSQELIVRRGQ
LIYMSLTLYPCLSCSRRVTFTASTGPYPSESAKTKAVFPLSNRISGTGWGAQLLRNENDV
ASISILSPANAPIGRYTLSIQISSEGNDSTLILGTFILLFNPWLQDDSVFMSNHDEREEY
VQEDAGVIFMGRASYISLIGWNYGQFEEGILNICLSLLDNSLNFRRDPATDVAHRDDPQY
VGRVLSAMINSNDDYGVVSGNWSGNYVGGQDPRNWNGSVEILKQWQMSGFRPVRYGQCWV
FAGTLNTVLRCLGIPSRVITNFSSAHDTDKNLSVDVYYDPRGWPMDKGSDSIWNFHVWNE
AWFARTDLSPSYNGWQVLDATPQERSQGVFQCGPASVAALREGNVDWDYDMPFIFAEVNA
DRITWIYDAWTGGLKKNSSNSYTVGKYISTKAVGSNSRMDVTGNYKYPEGSSQERQVFEK
ALGKLKPYTSSFGATSTRMFRREEREPSISGKFKITDILTVGKDVNLTLMLKNLTSDSKT
VMVNMTAWTIIYNGTLVHEVWKESVTLSLGPNEEIQHPVKIAYALYERYLKADNMIRATA
VCEISDETEAVVERDIILDNPTLNLEVLDQAHVQKPVTVQMLFSNPLEELVKDCKLIVEG
SGLLLGTLKIDMPNLRPREQSQVKFEILPTRSGTKQLLVTFSCNKFSAIKGMLPIKVVE
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggggctccctccaaaggcctccagttccatccagttagttcaactcagtcctcggatt
cggagggactgcccaaggctggcagttatgaacggtgggcttgtctgtgacagaagttca
tccacccgcaagtggacagcatctgcaggcgttctccacatgaagtgcggggagctgggc
tgcccctgctgtcccatgctcagagctgtcaggtgtgataaaggctcagtgatctcaagt
cttcttttctgtctcacggctttagaactccagagtgtcgactggcagataagcttcaat
gagcaggcacatcacacagacaagttctccagccaggagcttatcgtgcggagaggccaa
ctcatctacatgtcattgaccttatacccatgtctcagctgttccagacgtgtgacattc
acagcttccacagggccttacccctcagagtcggccaagacaaaggctgtgtttccactc
tccaacaggataagtggcactggctggggtgcacaacttctgcgcaacgagaacgatgtt
gcgagcatctccatcctcagtcctgccaatgcacctataggaagatacacgctgagcatt
cagatctcctccgagggcaatgactccactcttatacttggaacattcatattgctcttt
aacccctggttgcaagatgatagtgtctttatgagtaaccatgatgagagagaggagtat
gttcaggaagatgctggcgtcatcttcatgggaagagcaagttacattagcctgattggc
tggaactatggacagtttgaagaaggcattctgaacatttgcctctctctgctggataat
agtctgaattttcgccgtgaccctgctactgatgtggcccacagagacgacccccagtat
gttggccgggtgctgagtgcaatgatcaatagcaatgatgactatggtgtggtttctggg
aactggagtggtaactacgtaggtggccaggacccaaggaactggaatggcagcgtggag
atcctcaagcagtggcaaatgtctggcttcaggccagtccgatacggccagtgctgggtc
ttcgctgggaccctcaacacagtgctgcggtgtttggggattccctcccgagttatcacc
aacttcagctcagctcatgacacagacaaaaacctcagcgtggatgtgtactatgacccc
agaggatggcccatggacaaaggcagtgacagcatatggaatttccacgtctggaatgaa
gcctggtttgcacggactgacctaagcccatcatacaatggatggcaggttctggacgcc
accccccaggaaaggagccaaggggtgttccagtgcggccctgcttcagtcgccgctctc
cgagagggtaatgtggactgggactacgacatgcccttcatctttgccgaggttaatgcc
gaccgcatcacatggatctacgatgcctggactggcggcctgaagaagaattcctcaaac
tcttacaccgtcggcaaatatatcagtaccaaggcagtgggcagcaactctcgcatggat
gtcaccggaaattacaagtacccagaaggttccagccaggaaaggcaagtgtttgaaaag
gctttggggaaacttaaaccctacacgtcgtcgtttggcgcaacatctacaagaatgttt
agaagagaggaacgggagcccagcatctccgggaagttcaagatcactgacatactgaca
gtgggcaaagatgtcaacctgaccctgatgctcaaaaacctaacgagtgattcgaagaca
gtgatggtgaacatgacagcctggaccatcatctacaatggcacactcgtacacgaggtg
tggaaggagtctgtcaccctatccctgggtcccaatgaagaaatacagcatcctgtaaag
atcgcatatgcactgtacgagaggtacctgaaggcagacaacatgatccgggccacagcc
gtgtgcgagatcagtgacgagaccgaggcggtggtggagagggacatcatcctggacaac
cccaccctgaacctggaggtgctggaccaggcccacgtgcaaaagcctgtgactgtgcag
atgctcttctccaacccgctggaagagctggtgaaggactgcaagctgatagtggagggg
agtggcctgctgctgggcaccctcaagatcgacatgccaaacctgcgccccagggagcag
tcccaggtgaagtttgagatcctgcccacccgcagtggcaccaagcagctcctcgtcacc
ttctcctgcaacaagttctccgcgatcaagggcatgctgcccatcaaagtggtcgagtga

DBGET integrated database retrieval system