Leptonychotes weddellii (Weddell seal): 102739707 Help Entry 102739707         CDS       T08708                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww01523   Antifolate resistance lww04010   MAPK signaling pathway lww04014   Ras signaling pathway lww04024   cAMP signaling pathway lww04062   Chemokine signaling pathway lww04064   NF-kappa B signaling pathway lww04066   HIF-1 signaling pathway lww04071   Sphingolipid signaling pathway lww04137   Mitophagy - animal lww04151   PI3K-Akt signaling pathway lww04210   Apoptosis lww04211   Longevity regulating pathway lww04218   Cellular senescence lww04380   Osteoclast differentiation lww04613   Neutrophil extracellular trap formation lww04620   Toll-like receptor signaling pathway lww04621   NOD-like receptor signaling pathway lww04622   RIG-I-like receptor signaling pathway lww04623   Cytosolic DNA-sensing pathway lww04625   C-type lectin receptor signaling pathway lww04657   IL-17 signaling pathway lww04658   Th1 and Th2 cell differentiation lww04659   Th17 cell differentiation lww04660   T cell receptor signaling pathway lww04662   B cell receptor signaling pathway lww04668   TNF signaling pathway lww04722   Neurotrophin signaling pathway lww04917   Prolactin signaling pathway lww04920   Adipocytokine signaling pathway lww04926   Relaxin signaling pathway lww04931   Insulin resistance lww04932   Non-alcoholic fatty liver disease lww04933   AGE-RAGE signaling pathway in diabetic complications lww04936   Alcoholic liver disease lww05010   Alzheimer disease lww05022   Pathways of neurodegeneration - multiple diseases lww05030   Cocaine addiction lww05132   Salmonella infection lww05133   Pertussis lww05134   Legionellosis lww05135   Yersinia infection lww05140   Leishmaniasis lww05142   Chagas disease lww05145   Toxoplasmosis lww05146   Amoebiasis lww05152   Tuberculosis lww05160   Hepatitis C lww05161   Hepatitis B lww05162   Measles lww05163   Human cytomegalovirus infection lww05164   Influenza A lww05165   Human papillomavirus infection lww05166   Human T-cell leukemia virus 1 infection lww05167   Kaposi sarcoma-associated herpesvirus infection lww05168   Herpes simplex virus 1 infection lww05169   Epstein-Barr virus infection lww05170   Human immunodeficiency virus 1 infection lww05171   Coronavirus disease - COVID-19 lww05200   Pathways in cancer lww05202   Transcriptional misregulation in cancer lww05203   Viral carcinogenesis lww05207   Chemical carcinogenesis - receptor activation lww05208   Chemical carcinogenesis - reactive oxygen species lww05212   Pancreatic cancer lww05215   Prostate cancer lww05220   Chronic myeloid leukemia lww05221   Acute myeloid leukemia lww05222   Small cell lung cancer lww05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lww05321   Inflammatory bowel disease lww05415   Diabetic cardiomyopathy lww05417   Lipid and atherosclerosis lww05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102739707 (RELA)    04014 Ras signaling pathway     102739707 (RELA)    04064 NF-kappa B signaling pathway     102739707 (RELA)    04668 TNF signaling pathway     102739707 (RELA)    04066 HIF-1 signaling pathway     102739707 (RELA)    04071 Sphingolipid signaling pathway     102739707 (RELA)    04024 cAMP signaling pathway     102739707 (RELA)    04151 PI3K-Akt signaling pathway     102739707 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102739707 (RELA)   09143 Cell growth and death    04210 Apoptosis     102739707 (RELA)    04218 Cellular senescence     102739707 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102739707 (RELA)    04620 Toll-like receptor signaling pathway     102739707 (RELA)    04621 NOD-like receptor signaling pathway     102739707 (RELA)    04622 RIG-I-like receptor signaling pathway     102739707 (RELA)    04623 Cytosolic DNA-sensing pathway     102739707 (RELA)    04625 C-type lectin receptor signaling pathway     102739707 (RELA)    04660 T cell receptor signaling pathway     102739707 (RELA)    04658 Th1 and Th2 cell differentiation     102739707 (RELA)    04659 Th17 cell differentiation     102739707 (RELA)    04657 IL-17 signaling pathway     102739707 (RELA)    04662 B cell receptor signaling pathway     102739707 (RELA)    04062 Chemokine signaling pathway     102739707 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102739707 (RELA)    04917 Prolactin signaling pathway     102739707 (RELA)    04926 Relaxin signaling pathway     102739707 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102739707 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     102739707 (RELA)   09149 Aging    04211 Longevity regulating pathway     102739707 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102739707 (RELA)    05202 Transcriptional misregulation in cancer     102739707 (RELA)    05207 Chemical carcinogenesis - receptor activation     102739707 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     102739707 (RELA)    05203 Viral carcinogenesis     102739707 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102739707 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     102739707 (RELA)    05221 Acute myeloid leukemia     102739707 (RELA)    05220 Chronic myeloid leukemia     102739707 (RELA)    05215 Prostate cancer     102739707 (RELA)    05222 Small cell lung cancer     102739707 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102739707 (RELA)    05170 Human immunodeficiency virus 1 infection     102739707 (RELA)    05161 Hepatitis B     102739707 (RELA)    05160 Hepatitis C     102739707 (RELA)    05171 Coronavirus disease - COVID-19     102739707 (RELA)    05164 Influenza A     102739707 (RELA)    05162 Measles     102739707 (RELA)    05168 Herpes simplex virus 1 infection     102739707 (RELA)    05163 Human cytomegalovirus infection     102739707 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     102739707 (RELA)    05169 Epstein-Barr virus infection     102739707 (RELA)    05165 Human papillomavirus infection     102739707 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102739707 (RELA)    05135 Yersinia infection     102739707 (RELA)    05133 Pertussis     102739707 (RELA)    05134 Legionellosis     102739707 (RELA)    05152 Tuberculosis     102739707 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     102739707 (RELA)    05145 Toxoplasmosis     102739707 (RELA)    05140 Leishmaniasis     102739707 (RELA)    05142 Chagas disease     102739707 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     102739707 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     102739707 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     102739707 (RELA)   09165 Substance dependence    05030 Cocaine addiction     102739707 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102739707 (RELA)    05418 Fluid shear stress and atherosclerosis     102739707 (RELA)    05415 Diabetic cardiomyopathy     102739707 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102739707 (RELA)    04932 Non-alcoholic fatty liver disease     102739707 (RELA)    04931 Insulin resistance     102739707 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     102739707 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102739707 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:lww03000]     102739707 (RELA) Transcription factors [BR:lww03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     102739707 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  102739707 NCBI-ProteinID:  XP_030891354 UniProt:  A0A7F8RDW8 LinkDB All DBs Position Unknown AA seq 571 aa AA seqDB search SVRVLGGIPERRTTIGGKRSPSRDAHRVRRRSRGYGAGHVGPDLFPLIFSSEPAQASGPY VEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKD PPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNP FQVPVEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLSHPIFDNRAPNTAELKICRVN RNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADP SLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNG PADPRPPPRRIAVPCRSATSVPKPAPQSYPFTPSLSTINFEEFSPMVFSSGQIPNQTSAL APAPAPAPAPILAPGLAQAVVPPAPKTTQAGEGTLSEALLQLQFDADEDLGALLGNSADP AVFTDLASVDNSEFQQLLNQGVSVAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGA SGLPNGLLSGDEDFSSIADMDFSALLSQISS NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt tcggtccgcgtcctgggcggaatccccgaaaggcgcacaacgattggaggaaagcggagt ccgtcacgtgacgcccaccgggtgcgacgccggtcacgtggctacggcgcgggtcacgtg ggaccagacctgtttcccctcatcttctcgtctgagcccgcccaggcctccggtccctat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg cgctccgccggcagtatcccgggcgagaggagcaccgataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctccctggtcaccaaggac ccccctcaccggcctcacccccatgagcttgtgggaaaagactgccgagatggcttctat gaggctgagctctgcccggaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaacaacaatccc ttccaagttcccgtagaagaacagcgtggagactacgacctgaatgcggtgcggctctgc ttccaggtgacagtgcgggacccagcaggcaggcccctccgcttgtcacctgtcctctct catcccatctttgacaaccgtgcccccaacactgccgagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggagatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtatatttcacgggaccaggctgggaggcccgaggctccttttct caagctgatgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccgccgacccccggcctccaccccggcgcattgccgtgccttgccgaagcgcaacttct gtccccaagccagctccccagtcctatccctttacgccatccctcagcaccatcaacttt gaggagttctcccccatggtcttttcttcggggcagatcccaaaccagacctctgccttg gccccagcccctgccccagcccctgccccaatcttagccccaggccttgctcaggctgtg gtccccccagcccccaagaccacccaggccggggaagggacactctcagaggccctgctg cagctgcagtttgatgccgacgaagacctgggggccctgctgggcaacagcgctgacccc gccgtgttcacagacctggcatccgtcgacaactctgagtttcagcagctcctgaaccag ggtgtatctgtggccccccacacagccgagcccatgctcatggagtaccctgaggcaata acgcgcctggtgacagggtcccagaggccccctgacccagctcctgctcccctaggggcc tctgggctccccaacggcctcctctcaggggatgaagacttctcctccattgcagatatg gacttctcagcccttctgagtcagatcagttcctaa

DBGET integrated database retrieval system