KEGG   Microbulbifer agarilyticus: Mag101_11540Help
Entry
Mag101_11540      CDS       T04709                                 

Definition
(GenBank) ATPase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
maga  Microbulbifer agarilyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mag101_11540
Enzymes [BR:maga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mag101_11540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2770247..2771995
Genome map
AA seq 582 aa AA seqDB search
MKTIKAMMGSLMLAAFCSAVSANTPRTAFVHLFEWQWDDIAAECENVLGPKGFSAVQVSP
PQKSIGGSQWWTRYQPVSYQIEGRSGSRAQFQNMVNRCKAVGVDIYVDAVINHMAAWDRY
FPEVPYGPNDFHNCTSDINYGDAWSIQNCDLVGLNDLKTGSNYVQQKIADYLNDLTNLGV
AGFRIDAAKHMPASDINGIKNRLTGNPYIFQEVIGAGGEPVQPSHYNWIGDVTEFNFTNT
MGHYFKLRAPLKEISNIGNWQGWLPSSDAVVFVANHDNQRQNTENTITHKDGNNANKMAH
VFMLGWPYGYPKVMSSYDWHHHDQGPPSHGASSCSNGWLCEHRDREIANMVGFRNHTVAH
WGITNYWDNGNHQLAWGRGGLGFVVVNMEGSDLNRSFQTGMPAGEYCDIIHGDFDAANGS
CSGPTITVDTSGNANFSVYYRNASAIHVGARVGDVCTDCTGSSGGSSSGSGSGSGSSGGS
SSGGSPVETAFTCHNGYTYWGQSVYVVGNLDELGNWDPANAQKLDPNSYPTWNGSINLPT
NQSVEWKCLKREEQNPNAGIEWQSGSNNTFTSGQNSTPSASF
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccataaaagcgatgatgggatcactgatgcttgcggctttttgcagcgcagtc
agtgccaatactccgaggacggccttcgtccacctgttcgaatggcaatgggatgacatt
gccgcagagtgcgagaatgtacttggccctaaggggttttctgcggtgcaggtatccccc
ccacaaaaatccattggcggcagccagtggtggacccgttaccagccggtgagttaccag
attgagggtcgctccggcagccgtgcgcaatttcaaaatatggttaaccgctgcaaggcg
gttggtgtggatatttatgtagacgcagtaataaaccatatggcggcctgggatagatac
tttccggaagtaccctacggccccaacgacttccacaactgtacgtccgacataaactat
ggagacgcctggtcgattcagaattgcgaccttgttggcctgaatgacctgaaaaccgga
tcgaactatgtgcagcagaaaattgccgactacctgaatgacctgaccaacctcggcgtg
gccggtttccgtattgatgccgccaagcatatgccggcatcggatattaacgggatcaaa
aaccgtttgaccggtaacccatatattttccaagaagtgatcggtgccggtggagaacct
gtgcaaccgtcccattacaactggatcggagatgtaacggaattcaacttcaccaataca
atggggcactacttcaagctgcgagcgccgctgaaagagatcagcaatatcggcaactgg
caaggctggctcccgagttccgatgcggtcgtgtttgttgccaaccacgataaccagcgc
cagaacactgaaaacaccattacccataaagacggaaacaacgccaacaaaatggctcat
gtctttatgctgggctggccgtatggttacccgaaggtaatgtcgagctatgactggcac
caccatgaccagggcccgccatcacatggcgcaagcagttgtagcaacggctggttatgt
gaacaccgcgaccgcgagatcgccaacatggtgggctttcggaaccataccgttgcgcac
tggggtatcaccaattactgggacaatggcaatcaccaactcgcatggggccgtggcgga
ctcggcttcgtagtcgtgaacatggaggggagtgacctcaaccgcagtttccagacgggc
atgccggcaggagagtactgcgacatcattcatggggactttgatgcggccaatggatcc
tgcagcggccctaccatcaccgtggacaccagtggtaacgccaactttagcgtttactat
cgcaacgcgtctgcaattcatgtgggggcgcgcgtgggcgatgtatgcaccgattgcact
ggttcaagtggagggtcttcctctggaagtggttctggaagtggctcgagcggtggcagc
agttcaggtggcagccctgttgagactgcgttcacctgccataacggctacacatactgg
gggcaaagtgtgtatgtggttgggaatctcgatgagcttggcaactgggatcccgccaat
gcgcaaaaacttgaccccaacagctacccgacctggaacggttcaatcaatttgcccact
aaccagtcagtggagtggaaatgcctgaagcgtgaggaacagaaccccaacgccggtatc
gagtggcaaagtggttccaacaacacctttacctcggggcaaaactcgactccctctgcg
agcttttag

DBGET integrated database retrieval system