KEGG   Magnetospira sp. QH-2: MGMAQ_2574Help
Entry
MGMAQ_2574        CDS       T03795                                 

Definition
(GenBank) putative alanine racemase (alr)
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
magq  Magnetospira sp. QH-2
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:magq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MGMAQ_2574
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MGMAQ_2574
Enzymes [BR:magq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MGMAQ_2574
Peptidoglycan biosynthesis and degradation proteins [BR:magq01011]
 Precursor biosynthesis
  Racemase
   MGMAQ_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2629036..2630154
Genome map
AA seq 372 aa AA seqDB search
MKKTEARTGAILTIDLKALVDNWRLLRDRVAPRQCAAVVKADAYGLGMNRVAQALWNAGC
KVFFVAQIEEATTLRKRLREAEIHVLNGLLEGTESDFLAQNLIPVLNDIHQIRAWTQFCG
QTPRPCDIHLDTGMSRLGLSPEETEQLIADTDLCQALAPSLIMSHLACADSPNHKMNSGQ
LEEFTTLRQRLDAAGLRAPGSIANSSGIFLGADYHFDLARPGVAIYGVNPTPDNPNPMAQ
VVRLQAKILQVRTIDTPRAVGYGATHRVWGPSRIATVGVGYADGFLRTISNRGRAFIKDH
RAPVVGRISMDLTTLDVTAVPEQLTQPGCMVDLIGPHSTVDDVAQAAGTIGYEILTGLGN
RFLRVYSNGPGA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccgaagcccgaaccggagccatcctgaccatcgatctgaaagcgctggtc
gataactggcggctattgcgagaccgtgtggcaccccgccaatgcgccgccgtggtcaag
gccgatgcctatggcctgggcatgaaccgcgtggcccaagccctgtggaacgcaggctgc
aaggtgttctttgtggctcagatcgaggaagccacgaccctgcgcaagagactgcgcgag
gccgagatccatgtgctcaacggcctgctggaaggtaccgaatccgattttctggcccaa
aacctcattccggtgctcaacgacatccatcaaatccgtgcttggactcaattctgcggc
cagacacctcgcccttgcgatattcatctggatacgggcatgtcccgtctgggcctgtcc
ccggaggaaacggaacaactgatcgccgatacggatctctgccaggcattggcaccgagc
ctgatcatgagccacctggcctgcgccgatagcccgaaccacaagatgaacagcggacag
ctggaagagttcacaaccttgaggcagcggctggatgcggcaggtctgcgcgcgcccggt
tctatcgccaactcctcggggatcttcctcggagccgactatcatttcgacctggcccgg
cccggcgtggcgatctatggcgtcaacccgacccccgacaaccctaaccccatggcgcaa
gtagttcggttgcaagcaaaaatcctgcaagtccgtacaattgacaccccccgggcggtt
ggatatggtgccacccatcgcgtctggggtccgtcccgcatcgccacggttggcgtcggt
tatgcggatggctttttgcgcacgatcagtaacagggggcgagccttcatcaaagaccat
cgcgccccggtggtgggacgcatctccatggacctgacgaccctcgacgtgaccgctgtc
ccagaacagctgacccagccagggtgtatggtggatctgatcggcccccacagcacggtg
gacgacgtcgcccaggcagcggggaccattggctatgagatcctcacaggccttggcaat
cgctttctgcgggtctacagcaacgggccaggcgcatga

DBGET integrated database retrieval system