KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1242Help
Entry
MICA_1242         CDS       T01630                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MICA_1242
  Energy metabolism
   00680 Methane metabolism
    MICA_1242
Enzymes [BR:mai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MICA_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1226673..1229591)
Genome map
AA seq 972 aa AA seqDB search
MNNQIDTPIQDKSYTRRMERLLTRRYMGIVATQDPDSFALIARRKDIQQGENKTTRMKEY
VALWQGLSADQQLKLAEHDAKINHLARLARTLATTTVVQAHNKIKTTTAGSIDFVMRRFR
EEGVAPEQVQQFLDDNAVAWFSITGHPTNPTTVDYTIAQTDVARVIVDPSATPDDLHDAL
LHLYQTPIVGDRKTPLDEARESINTLNSIYDVALAHRDLFIKAIADHGYADQGVNITRAL
IVPCSWTLGDADGNPALTAQVLADGIALHRQAIADRYQLTLQSIHTDHQPTMLALHTLQK
ILAQAGPQTQIDSVCQKIQSIIADCPDEAAQKQIQDFRYLLHCFGFGFGTIDIRHNAVDI
LAAVKKLAVLCGLENKQDMDAIGLDHIQLKLAAWLRDDAVLSRMASATDLPDDESAMIVG
RLRVIGQNPDMCEKLIIAETTHPAHALAALLLLKITGNVVADDGARIDLTMLSESVHDLM
NLGNTLETLLDNETFRAHVAARGRLLVMIAKSDTTRQDGRGEAEYAQYEAAIDIYRVAEK
MRRKYRDLRHVLPSIMNGGGHALQRGGGRVTEIPAVHGRAAADARATDIGPSTLTVQGHQ
QNVLFCPGPVAVGTMEALAAQNLYSKAGIYGEMPDPVSRPGLNRHHGQYDAWLYAQTAGR
AFDTLTQKNVAIDELLVRAPWLAMKAGNASSRPAKRGEKMVGPGITPREAIGVDPRALQG
RAISGERLTAHACLPIFSVLGLVEAMISVRDHGRASRNPEKYGDGLHHLYRAHKIHRDGA
RATLNASIMADFDIAWPLLVGDERPPRTIVEKLAAQFLHHDPDHNNTPAITLAFLEQYFL
NVERLSYEMVSGQKAKKNFNHGDGLRILWPELFHEMSIRNRAAEFSRVIECYRTVQMDRA
PDIPLDETQFRITQNLYAAADVVNAPIGILATRTRLEPVYDLRGGVKTRFMKPESYLESD
VAGLLSLPPALS
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcagatagatacccccattcaggacaaatcatacacgcggcggatggagcgt
ttgctgacgcggcgatatatggggattgtggcaacgcaggaccccgatagttttgcgttg
atcgcacggcgcaaggacattcagcagggtgagaataaaaccacacgcatgaaagaatac
gttgcgttgtggcaagggctgagcgcggaccagcaattaaaactggccgaacatgatgcg
aagatcaatcacctcgcccgactggcgcggacattggcaaccaccacggtggtacaggcg
cataacaaaatcaaaaccaccaccgccggatcgattgatttcgtcatgcgacggtttcga
gaggaaggcgtcgccccggaacaggtccagcaatttttggatgataatgcggttgcgtgg
ttcagcatcaccggccaccccaccaatccgacaacggtggattacaccatcgcccaaacc
gatgtggcccgtgtgattgtagacccctccgccacgccggatgatttgcacgatgccctg
ctccacctttatcaaacacccattgtgggggatcggaaaacgccgctggatgaagcgcgg
gagagtatcaacaccctcaattccatttacgatgtcgcgctggcccaccgggatttgttt
atcaaggcgattgcggatcatggctatgccgatcagggcgtgaatatcacccgcgcattg
attgtaccatgttcatggacattgggtgatgccgacggcaaccccgccctgaccgcgcaa
gtcttggccgatgggattgccctgcaccgtcaggccattgccgatcgttatcaactgacc
ttgcaatccattcacacggatcatcaaccgacgatgctggccctgcatacattgcaaaag
atattggcacaggccgggccgcagactcagattgattccgtttgccagaaaatccaatcc
atcatcgccgattgcccggatgaagcggcgcagaaacagattcaggattttcgttatctg
ttacattgtttcggatttggatttggcacaattgatattcgccacaatgccgttgatatt
ctggccgcggtgaaaaaattggccgttttatgtgggctggaaaacaaacaggatatggat
gcgattggtctggaccatatccaattaaaactggcggcatggttgcgtgatgacgcagtt
ttgtcgcgcatggcgtccgccaccgatctgcccgatgatgaatccgcgatgattgtcggg
cggttgcgcgtgatcgggcaaaacccggatatgtgcgaaaaactgatcatcgcggaaacg
acgcacccggcccatgcgctggcggcgttgctcctgctgaaaatcaccgggaatgttgtg
gcggatgacggggcgcggattgacctgaccatgttatcggaatccgtgcatgatttgatg
aatctgggcaatactctggaaacattgctggataacgaaacgttccgcgcccatgtggcg
gcgcgcgggcggttattggtgatgatcgccaagagcgacaccacgcggcaggatggccgg
ggcgaagccgaatacgctcaatacgaagccgcgatcgacatttaccgcgtggcggaaaaa
atgcggcggaaatatcgtgacctgcgccatgtcctgcccagcattatgaatggtggtggc
catgccctgcaacgtggtggtggccgtgtcaccgaaattcccgccgtgcacgggcgggcg
gcagcggatgcgcgggcgacggatattggtccctccaccctgaccgttcaggggcaccag
caaaacgtcctgttctgccccggcccggttgccgttggcacgatggaggcgttggccgca
cagaatttatacagcaaggcgggtatttacggtgaaatgcccgaccccgtatcccgcccc
ggcctgaatcgtcaccatgggcaatatgatgcgtggctgtacgcgcaaacggccgggcgt
gcatttgataccttgacgcaaaaaaatgtggcgattgatgaattgctggtccgtgcgccg
tggctggccatgaaagcgggcaatgccagttcccgccccgccaagcgcggtgagaaaatg
gttggccccggcattaccccgcgcgaagcgattggcgttgatcccagggcgttacagggg
cgcgccatttccggcgaacggttaacagcccatgcgtgcttgcccattttttccgttctg
ggtttggtcgaggcgatgataagcgtgcgcgatcatggtcgcgccagccgcaacccggaa
aaatatggtgatggtttgcaccatctttaccgtgcgcacaaaattcaccgcgacggggcg
cgggccacactcaacgcatcaatcatggcggattttgatattgcatggccgttattggtc
ggtgatgaacgtccgccccgcacgattgttgaaaaactggccgcgcaattcctgcatcac
gatccggatcacaacaatacacctgcgatcacattggcgtttctggaacaatatttcctg
aatgttgaacgattaagctatgaaatggtgtccgggcaaaaagcgaagaaaaatttcaat
cacggcgatggtttgcgtattctgtggccggaattatttcatgagatgtccatccgcaat
cgggccgctgaattttcgcgtgttattgaatgttatcgcactgtgcagatggacagagcc
cccgatattccactggacgaaacccaattccgcatcacacagaatttatatgccgccgcc
gatgtggtgaatgcgcccattggtattttggccacgcgcacacggttggaacctgtttac
gacctgcgcggtggcgtcaaaacccgctttatgaagccggaaagttatctggaaagcgat
gtggcagggttgttatcgttgccgcctgcccttagctga

DBGET integrated database retrieval system