Metarhizium robertsii: MAA_03666 Help Entry MAA_03666         CDS       T03107                                  Name (RefSeq) MAPEG family protein   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism maj  Metarhizium robertsii Pathway maj00480   Glutathione metabolism maj01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:maj00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     MAA_03666  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:maj02000]     MAA_03666 Enzymes [BR:maj01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      MAA_03666 Transporters [BR:maj02000]  Other transporters   Pores ion channels [TC:1]    MAA_03666 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  19257952 NCBI-ProteinID:  XP_007819855 UniProt:  E9EUG7 LinkDB All DBs AA seq 122 aa AA seqDB search MLRTSQLRKASGVVYPNSYASAERAEKDGKAYAFNCAQRAHANFTENHTSFLGALLISGL RFPMAAAAVGAAWTVFRILYLFGYTSQAGPRGRTTGALGSILADLILKFMAAYTSAKLVF GN NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgctgcgaacctcccagcttcgcaaggctagtggtgttgtgtaccccaactcatatgcc tcggcggaacgggcagaaaaggatggcaaagcttatgcctttaattgcgcccagcgtgct cacgcaaactttaccgagaatcacacgtcattcctcggcgccctccttattagtggcctg cgttttcctatggcagcagctgccgtaggtgctgcttggaccgtgtttcgcattctgtat ctcttcggatataccagccaggccggcccccggggtcgaacaactggtgccctgggttct atcttggcagatcttattctgaagttcatggctgcttacacgtctgctaagctcgtgttt ggaaactga

DBGET integrated database retrieval system